KEGG   Chrysemys picta (western painted turtle): 101942903
Entry
101942903         CDS       T04662                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpic03036]
    101942903 (ANKRD53)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101942903 (ANKRD53)
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 101942903
NCBI-ProteinID: XP_005291563
Position
Un
AA seq 493 aa
MTHTAVIKKAFNKDLSRLIRGVPYQDKLIVLEDFNADTWSWVRGHHGIGRGTPKSTRVCK
KFYGGKYEHMAATVGNLHWLQESLQKAESPNQADINVNPICEVNGFSAIHLAALHGRLEC
LKLVVEKFEVDVNLASLTGWTPIHLVMNKESGPRALECLQYLIGKGADINVQNQGGTSPL
HKAASEGRLNCIIELVEAGADVHAKDAEGQQPIDLCRIWAHRSCARYLSDAMWKTDKRNF
AREMHKLNQIKSECQRSEQNFWKIDKREQELLNTMAFSHWLRMKQQQQFPDSAKRMHFPE
DRAKLDAVPKKEVAKPPPGEKKISVPAKPRAKVKGEPRLSAPAQPPTGKSQRAWNASVNP
SSPLVTDIFRPTTVRLGTDPEACGDHDFSSFLFLSKDSHGQPVIEMAYNGRLSPVPNLPY
EVIERSLYPHTRPIRVTMPQGFKPTHIFDVKRKRLPSLEHRWTDQMAVSLRETLDPAFRA
TLKAHRSAINYGG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgactcatacagccgtgatcaagaaggcatttaataaagatctcagcaggctcatcaga
ggggtcccgtaccaggacaaactcattgtccttgaagactttaatgctgacacatggagc
tgggtgcgaggccatcacggcattggaagaggcactcccaaatcgaccagagtctgtaag
aagttttatggagggaagtatgagcatatggcagccaccgtgggaaacctgcactggctc
caggaaagtctgcaaaaagctgagtcgcccaaccaagccgatatcaatgtaaatcccatt
tgtgaggtgaacggcttctcagccatccatctagcagctctacacggccggctggagtgc
ctgaaactggtagtcgaaaagtttgaggttgatgtgaacttggccagtctgacaggatgg
acacccattcacctggtgatgaacaaggagagtggccccagggcattggagtgtttgcag
tacctcattggaaagggggcagacatcaatgttcagaaccagggcggaacgtcgccactt
cacaaggcagccagtgaaggacgcctcaactgcatcattgaactggttgaggctggagct
gatgtccatgccaaggacgcagaggggcagcagcccattgacctctgcaggatatgggcc
cacaggagctgtgccaggtacctgagtgatgccatgtggaaaacagacaagcgcaatttt
gctcgcgaaatgcacaaactgaaccaaatcaaaagtgaatgtcagcgctccgaacaaaac
ttctggaagatagataagagggagcaggaactcttgaatacaatggcattttctcactgg
cttagaatgaagcagcaacagcagttccctgactctgctaaaaggatgcattttcccgag
gacagagcgaagctggacgctgtccccaagaaggaagtggccaaaccacctcctggagaa
aagaaaatcagcgtacctgccaagccgagggctaaagttaaaggggaacctcgtttatct
gcccctgctcagccccccactgggaaatcacagcgcgcttggaatgccagcgtcaatcca
tcctcccctctggtgacagacatattccgacctacaacagtccggctgggcaccgacccc
gaggcctgtggggatcatgacttcagctccttcttgtttctctccaaggactcgcacgga
cagccggtgatcgaaatggcttacaatggcagactctcccccgtccccaacctgccctat
gaagtgatcgagaggagcctgtatccccacactcggcccatcagagtaacgatgccgcag
ggatttaaacccacgcatatcttcgatgtgaaaaggaagcgtctcccgagcctggagcac
aggtggacggaccaaatggctgtgagcttgcgggaaactctggacccagcattccgagct
acgctaaaggctcaccgctctgcaatcaactacggcggctag

DBGET integrated database retrieval system