KEGG   Chrysemys picta (western painted turtle): 101943615Help
Entry
101943615         CDS       T04662                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpic04131]
    101943615 (DOCK7)
Membrane trafficking [BR:cpic04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101943615 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 101943615
NCBI-ProteinID: XP_008166091
Position
Un
AA seq 2064 aa AA seqDB search
MDSGPLRDLLEFPPDDIEVVYSPRECRTLVSAVPEESEMDPHVRDCVRSYTEDWAIVNRK
YHKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNSYQDEQDDLKRRSMSIDDTPRGS
WACSIFDLKNSLPDALLPNLLDRTPNEEIDHQNDDQRKSNRHKELFALHPAPDEEEPIER
LCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFYFDLNSEQMK
GMLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEPYMIFKEADA
AKNKEKLEKLKSQAEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDSTEVEIGTGERK
GSWSERRNSSIVGRRSLERTTSGDETCNLTSFRPATLTVTNFFKQEGDRLSDEDLYKFLA
DMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVRPTREILEFPA
RDVYIPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMPVIFGKSSCPE
FSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQNTPLETPVGYT
WIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFNVEVVAVSSI
HTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSSQLEPVVRFLH
LLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNQDQHGRNNLLTSYIY
YVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNSNPDISGTPTS
PDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQATDRSCNRMSSHTETSS
FLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWFFFELMVKSMVHHLYFADKLD
APRKNRFPERFMDDICALVSTIANDIVSRFQKDTEMIERLNTSLAFFLNDLLSIMDRGFV
FSLIKACYKQVSSKLYSLPNPSILVSLRLDFLRIICSHEHYVTLNLPCSLLTPPASPSPS
VSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLHK
KVINMVHNLLSSHDSDPRYSDPQVKARVAMLYLPLIGVIMETVPQLYDFTETHNQRGRPS
CVTVDDYESEGGSMISQTVAMAIAGTSVPQLTRPSSFLLTSTSGRQHSTFSAESSRSLLI
CLLWVLRNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSK
DMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNTEKLD
KSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLKVLLHSMACNQ
SALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIRSHASASLYLL
MRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFP
DQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHS
ERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPD
EEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHG
KLQEAFSKIVHQSTGWEDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHR
LEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNY
NLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINVSHKEEIILTPIEVA
IEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFR
HHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQL
YKAVLPVACHRDSFSRMSLRKMDI
NT seq 6195 nt NT seq  +upstreamnt  +downstreamnt
atggattccggacctttgagggacttgcttgaatttcctccagatgatattgaagttgtg
tacagtcctcgagaatgtaggactcttgtgtcagctgtacctgaagagagtgaaatggac
cctcatgtgagggattgtgtaagaagttacacagaagattgggcaattgtgaacagaaaa
tatcacaaactgggaaccggatttaatcccaacacattagacaaacagaaagagaggcaa
aaagggctccccaaacagatcttcgagtcggatgaggctccagatggcaacagttaccag
gatgaacaagatgaccttaaaaggcgttcaatgtcaatagatgatactccacggggcagc
tgggcatgcagtatttttgatctgaagaactcccttcctgatgctcttcttccaaaccta
cttgaccgaaccccaaatgaggaaatcgaccatcaaaatgatgaccagaggaagtcaaac
agacacaaggagctttttgcattgcatccagcaccagatgaggaggagcctattgaacgg
ctttgtgtcccagaagtacccaaagaacattttggtcagagacttcttgtgaagtgtttg
tctcttaaatttgaaattgaaattgaacccatttttgcaagtttggctttgtatgatgtt
aaagaaaagaaaaagatttcagagaacttctactttgatttaaactctgaacaaatgaaa
ggaatgctgcgtcctcatgtcccacctgctgccattaccactctggccagatcagccatc
ttttctattacttatccctctcaggatgtctttctggtaataaagctggaaaaagtatta
cagcagggggatattggcgaatgtgcagagccctatatgatttttaaagaagctgatgcg
gcaaagaataaggagaaactggaaaagttgaaaagccaagcagaacagttttgccaaaga
ctaggcaaatatcgaatgccttttgcctggacagccattcatttaatgaacatagtcagc
agtgctggaagtttggagagagattccacagaagtagaaattggcacaggagaacgcaaa
ggatcttggtcagagagacggaattccagtattgttggaaggcgttcattagaaaggaca
accagtggagatgaaacttgcaaccttactagctttagaccagctactcttacggtgaca
aacttctttaaacaggaaggggatcgcttaagtgatgaagatttgtacaagttccttgcg
gatatgagaagaccatcttccgttttacggaggttgagacccattacagctcagctgaag
atagacatatctccagccccagagaatcctcattactgtctaactccagaattgctgcaa
gtcaaactgtacccagatagcagagttagacctacaagagagatactggagtttcctgct
agggatgtgtatattccaaatactacttacagaaatcttctgtatgtctaccctcagagc
cttaactttgccaaccggcagggctctgccaggaatatcactgtgaaagtccagtttatg
tacggagaggatccaagcaatgccatgccagttatctttggtaaatctagctgtcctgaa
ttttcaaaagaagcatacacagcggtagtatatcataacagatcgcctgattttcatgaa
gaaatcaaaattaaactccctgccactttaactgatcatcaccacctgctttttactttc
tatcatgtcagttgccaacaaaaacaaaacacgcctcttgagacgccggttggatacact
tggataccaatgcttcaaaatggacgtttgaagactggtcagttctgcctacctgtttca
ttggaaaaaccaccacaggcttattctgtgctttctccagaggtgccccttcctggaatg
aagtgggtagataatcacaaaggagttttcaatgtagaagttgttgccgtatcatccatc
cacacacaggacccttaccttgacaaattctttgcacttgttcatgctctggacgagcac
atgtttcctgtgcgaataggagacatgagaattatggagaacaatttggaaaatgaattg
aagagcagcatttcagctttaaattcatctcagctggagccggtagtgcgatttcttcat
ctcctgcttgacaagctgattcttctggttgtgagacctcctgtcattgcaggccaaata
gttaacctgggtcaagcatcttttgaagcgatggcatcaatcataaacagactccacaaa
aacttagaaggaaaccaggaccagcatggccgaaacaaccttctcacttcctatatttat
tatgtttttcgtctaccaaatacctatcccaattcaccttcaccaggtcccggtggtttg
gggggatccgtgcattatgctactatggctcgatcagctgtccgaccagcaagccttaat
ttgaatcgctcaaggagtcttagtaacagcaatccggatatatctgggactccgacctca
ccagatgatgaagtacggtcaatcattggaagtaagggtttagaccgctccaattcctgg
gtaaacactggtggtcccaaagctgccccatggggatccaaccccagtccaagtgcagag
tcaacacaggctacagatcgaagttgtaatcgtatgtcttcgcacacagagacgtcaagt
ttcttacaaacattaacaggacggttaccaactaaaaagctttttcatgaagaactggcc
ttacagtgggtcgtctgcagtggaagcgttcgggaggcagctttacagcaggcgtggttt
ttcttcgagcttatggtgaagagtatggtgcatcatttgtattttgctgacaaactggat
gctccaaggaagaatcgttttccggaacgttttatggatgacatatgtgctctggtcagc
acaattgccaatgatatagtctctcggtttcagaaggatacagaaatgattgaaaggctc
aacaccagtcttgcatttttcctcaatgatctgctgtctatcatggatagagggtttgtc
tttagccttattaaggcctgctacaaacaggtgtcttcaaagctttattctttaccaaat
ccaagtatccttgtatccttgaggctggacttcctccgcattatctgcagccatgagcac
tacgtcaccctgaatttaccctgtagcctactcacgccacctgcatctccctcaccatct
gtgtcttcggcaacttctcagagttctggattctctacaaatgtccaagaccagaagatt
gcaaatatgtttgaattgtctgtgcctttccgccagcagcattacttggcagggcttgtg
ttaacagagctggctgtcattttagatcctgatgctgaaggtttgtttggattgcataag
aaggtcatcaatatggtacacaatttactgtccagtcacgactccgatccacggtactct
gacccacaggtaaaggcccgggtggctatgctgtatctacctctgattggcgtgatcatg
gaaaccgtgcctcagctatatgattttacagagactcacaatcagcgaggaaggccaagc
tgcgtcaccgtcgacgattatgaaagcgaaggtggaagcatgataagtcagacagttgcc
atggccattgcaggaacatctgtcccccagctcacccgacccagtagttttctactcaca
tcaacgagtggtcggcagcactcgaccttctcagcagaatccagccggagcctcttgatc
tgcctcttgtgggttctcaggaatgccgacgaaagcgtcctgcagaaatggttcacagac
ctctccgtgctgcagctcaatcgcttgctggatttgctgtatctctgcgtctcctgtttt
gagtacaagggcaagaaagtgtttgaaaggatgaacagtctgacatttaagaagtcgaag
gacatgagagcaaaacttgaagaagctattttgggaagcataggggcaaggcaagaaatg
gtgcgaagaagcagagggcagctagaaagaagtccatctgggagtgcgtttggaagtcaa
gagaatctaagatggagaaaggatatgactcactggcgtcaaaacacagaaaagcttgac
aaatcaagggcagagatagaacatgaagcgcttattgatggaaatcttgcaactgaagca
aatctgattattttggatacattagaaatagttgtccagacggtgtctgtgacggaatcc
aaagagagcattctcggtggggtgctgaaagttcttctccacagcatggcctgtaatcaa
agtgcactttatctgcaacactgcttcgccacgcagagagctctggtttcaaagttccct
gagctgctgttcgaagaagagaccgagcagtgtgctgatctctgcctgaggcttctgcga
cactgcagcagcagcattagtaccatacggtcccatgcgagtgcctctctttacctcctt
atgaggcagaacttcgagattggaaataactttgccagagtgaaaatgcaggtgaccatg
tccctctcgtccctggtgggaacgtcccagaatttcaatgaggaatttttgagacgttct
ctgaagactattttgacgtacgctgaagaagatctggaactccgggagacgacattccca
gatcaggtccaggatcttgtgttcaacctccatatgatcctctctgatacggttaaaatg
aaggaacaccaggaagatccagaaatgctgatagacttgatgtacagaattgcgaagggc
tatcagacttccccagatctgcgactgacctggttacaaaacatggctggaaagcattct
gaaaggagcaatcatgctgaatctgcccagtgtttggtccactcggcagcccttgtggct
gaatatttaagcatgcttgaggatcgaaaataccttccagtagggtgtgtaacatttcag
aacatatcttcaaatgttttggaagaatccgcagtttctgatgatgttgtctcaccagat
gaagaaggtatctgttctgggaagtattttacagaagcaggtctggtgggattgctggaa
caggctgcagcatctttctccatggctggcatgtatgaagcagttaacgaggtttacaaa
gtccttattcctattcatgaagctaacagagatgccaagaaactgtccacaattcatggt
aaactccaagaagcattcagcaaaattgttcatcagagtactggctgggaggatggaaag
cggatgtttggtacatacttccgggtcggtttttacgggactaaatttggagacttggat
gaacaagaatttgtgtacaaggagcccgcgataacaaagctagccgaaatttcccataga
ctagagggattttacggcgagcgatttggtgaagatgtggttgaagtgattaaggactct
aaccctgtagacaaatgcaaactagatcctaacaaggcctacattcagataacctatgtg
gagccctacttcgacacatacgagatgaaggacaggataacctattttgacaaaaactac
aacctgcggcgtttcatgtactgcacgcccttcaccctggacggacgtgctcatggggag
ctgcatgaacagttcaagcggaagacaatcttgacgacctcccatgcttttccttacatt
aaaaccagaataaatgtcagtcacaaagaagagataattttgacacccatcgaagttgcc
atagaggacatgcagaaaaaaacacaggaattggcttttgcgactcatcaagatccagca
gacccaaagatgctccaaatggtgctgcaaggttcagtaggtacaacggtaaatcaggga
ccattagaagttgcacaggttttcttgtctgaaatacccaatgatccaaagctcttcaga
caccataacaaactacggctctgtttcaaagacttcacaaaaaggtgtgaagatgcgtta
cgcaaaaacaaaagcctgataggtccagaccaaaaggaatatcagcgggagcttgaaagg
aactatcaccggctcaaggaagcgctccagcccttgataaatagaaagatcccgcagtta
tacaaggcagttttgcctgtcgcttgccacagagactccttcagcagaatgagccttcgc
aaaatggacatctaa

DBGET integrated database retrieval system