KEGG   Chrysemys picta (western painted turtle): 101944291Help
Entry
101944291         CDS       T04662                                 

Definition
(RefSeq) guanylate cyclase 2G-like
  KO
K22600  guanylate cyclase 2G [EC:4.6.1.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00230  Purine metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101944291
Enzymes [BR:cpic01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101944291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 101944291
NCBI-ProteinID: XP_005293971
Position
6
AA seq 1087 aa AA seqDB search
MGPCYILRLILNLIPIHDATVITLIAVVFANALDRGLETSTLIVAFQAPWNASHPLSAQK
LGSAIQIAIEKVNSDPSYLGNYTLDFVYADCGCDAKKSVNAFINQVQTENVSALFGPVCS
EAAEVTGLLASHWNIPWFGFVGQSAKLDNADLYDTYVKLVSPLQRIGEVLHKSLQYFGWK
YVGLFGGSSDASTGEKIDELWMSVENQLQVNITITAKVRYSTEDPSLHQENLKYISSVAR
IIVLICSSSDVRSIMLEAKHLGLVNGKFVFFVLQHFQDNFLKQALSSEKNSSVLEAYQPV
FLISLNPYGGYTMYSDFLKQVHEKLKGQPFYSSLASEEEVSSYSAYLHDAVLLYALSIRE
MLKEGKDISDGRALVNTLKGYNKTRLYGVTGLVYIDESGERWMDYSVYCLQKAGNSSQFV
PILNYDVERKTISPTTEIAYISWLADFPPKDRPYCGFYNEQCETSVISTPVTVLIVVLLV
TASGAASIMVFLKIQERKLQKQMDDIWWKINYNDIIMLKDHKDHFELSQTSTPVSKGQES
VGSSLIFSSNWRSGLKDKQGKDVFYTAIGLYQGTLVAIRYIDNQTDTWIRKQSVLHEVQM
MRELRHENLVAFFGICTEIPNICIITEYCKKGSLKDILRNSDIELDWIFKLSLAYDIVNG
MLFLHRSPLNSHGNLKPTNCLVDSRMQVKLCGFGLWEFKYGKKYRVITEKNTNYADLYWT
APELLRMGEFPFHGTQKGDVYSFAIIMRELIYNNEDGPFQDLNKEAEEIINRLRDPTVLV
PLRPSLSTEKCSERIIAMLRTCWDEDPGRRPTFSSVKRGLRDASPEGHISILDNMVNKLE
KYANHLEDVVEERTAQLVAEKKKTDKLLSAMLPSFIREQLIAGKSVEPESFDSVTIFFSD
IVGFTNLCSLSNPLQVVNLLNDLYSLFDNIIKTYDVYKVETIGDAYMVASGLPIRNGMKH
VEEIATMSLHFLSAMIPFKIEHMPEEKLKLRIGINTGPVVAGVVGITMPRYCLFGDTVNT
ASRMESTSLPLRIHVSTTTANALQSIGGYDLQERGTITVKGKGEQRTFWLKGKADLHLAL
PEFSDKW
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgggtccttgttatatactgaggctcattctgaatttgattcctatccacgacgctacc
gtaataacacttattgctgtggtctttgctaatgctttagatcgtggactggaaacgtct
acgcttattgtggcatttcaagctccttggaatgcttcccacccacttagtgcccaaaag
ctgggctcagctatccagattgccattgagaaagtcaattcagacccatcttacctgggt
aactacaccttggattttgtttatgctgattgcggctgtgatgccaagaagtccgtcaat
gctttcatcaatcaggttcagacggagaacgtttcggccctgtttggacctgtctgctca
gaagcagctgaggttactggtttgctggcttctcattggaatatcccctggtttggattt
gttggccagagtgcaaagctggacaatgcagatctatatgacacctatgtcaaacttgtc
tcccctctgcaaaggataggggaagttctgcataaaagtctgcaatattttggctggaaa
tatgttggattatttggaggttcatctgatgcttccaccggggagaaaattgatgaactc
tggatgtctgtcgaaaaccaactccaagtcaatatcactatcactgctaaagtcagatac
agcacagaagatccaagtctccaccaggaaaacctcaaatacatatcgtctgttgccaga
attattgttttaatctgcagctcttcggatgttaggtctatcatgctggaagccaaacat
ctagggctggtgaatgggaaatttgtgttcttcgttttgcagcactttcaggacaatttt
ttgaaacaggcactgagcagcgagaagaacagcagtgtacttgaagcctaccagccagtg
tttttgatttccctcaacccttatggaggatacactatgtactcagattttctgaagcag
gtccatgaaaaactgaagggacagccattttacagctcacttgcttcagaagaagaggtg
agttcttactctgcctacctgcacgatgcagtcctgctctatgccctgtccataagggaa
atgttaaaagaaggcaaagatatcagcgatggacgggcacttgtcaatactttgaaaggc
tacaacaaaactcgtttgtatggggttactggcctggtgtatatcgatgaatcaggtgag
aggtggatggattactctgtatattgtctgcagaaagctgggaattcatcacagttcgtt
cctattcttaattatgatgtcgagagaaaaacaatcagcccaaccacagaaattgcctac
atcagctggctggctgactttcctcccaaagacagaccgtactgtgggttttataatgaa
cagtgtgaaacttcagttataagtacgccagtgaccgttctgattgtcgtcctgttggta
accgcctcaggagctgccagcataatggtgtttttaaagatccaggaaaggaagctacaa
aagcaaatggatgacatctggtggaaaataaactacaatgatattattatgcttaaagat
cataaggatcattttgagctatcacaaacaagcacaccagtgtctaaaggacaagaaagt
gttgggtccagtttgatattttcaagcaattggcggtctgggttgaaggacaagcagggg
aaagatgtattttatactgcaataggtctttaccagggaactcttgttgcaatcaggtac
attgacaaccaaacagatacctggattcggaaacagtcagtccttcatgaagttcagatg
atgcgcgagttgaggcatgagaatctggtggccttctttggtatatgcactgaaattccc
aatatctgtattattacagagtattgcaagaaaggaagcctaaaggacattttgaggaac
tctgatattgaattggactggatattcaaactctctctcgcctatgatatagtcaatggg
atgttgtttcttcacagaagcccattgaactcccatggaaatctgaaacctactaactgt
ttggtggatagtcgcatgcaagtgaaactgtgtggatttgggctatgggagtttaagtat
ggaaagaaataccgagtaattactgagaaaaataccaactatgcagatctctattggaca
gccccagaactgctcaggatgggggaatttccattccatgggacccaaaagggggatgtc
tacagctttgctataattatgagggagctgatttataacaatgaggatggcccgttccaa
gacctgaacaaggaagcagaagagataataaaccgactcagggacccaactgtactcgtc
ccactgcggccatccctgtcaacagagaaatgcagtgaaaggatcattgcaatgcttaga
acgtgttgggatgaagatccagggagaaggccaacgttctcctctgtgaagagagggtta
agagatgcaagccccgaaggccacatcagcatcttggataacatggtaaacaaactggaa
aagtatgccaatcatttggaggacgtggtggaagaaaggacagcccagttggtggcagag
aagaaaaagacagataaacttttgtcagcaatgttgcccagcttcatccgagagcagctc
atcgctgggaaatccgtggagcctgagagttttgattctgtgaccatcttcttctcagat
attgttgggttcaccaatttgtgttctctcagcaatcccctgcaagtggttaatctcctg
aatgacctgtacagcctgttcgataacatcattaaaacgtatgacgtatacaaggttgaa
accatcggagatgcctacatggttgccagtggccttcccatccgcaatggaatgaagcac
gttgaggaaattgctacaatgtctttgcacttcctcagtgcaatgatccctttcaagata
gagcacatgcccgaagagaagctgaagctgcggattggcattaacacaggacctgttgtt
gcaggagtggtgggaatcacaatgccacggtactgcctgtttggagacactgttaataca
gcctcaaggatggaaagtaccagtttgcctctccgaatccatgtctccacaaccactgct
aatgccttgcaatccatcggcgggtatgacttgcaagaaagagggaccataacagtaaag
ggaaaaggagaacaaagaacgttttggttaaaaggaaaagctgaccttcacttggctctc
ccagagttcagtgacaaatggtga

DBGET integrated database retrieval system