KEGG   Chrysemys picta (western painted turtle): 101944444Help
Entry
101944444         CDS       T04662                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00250  Alanine, aspartate and glutamate metabolism
cpic00270  Cysteine and methionine metabolism
cpic00280  Valine, leucine and isoleucine degradation
cpic00350  Tyrosine metabolism
cpic00360  Phenylalanine metabolism
cpic00380  Tryptophan metabolism
cpic00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpic01100  Metabolic pathways
Module
cpic_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101944444
   00270 Cysteine and methionine metabolism
    101944444
   00280 Valine, leucine and isoleucine degradation
    101944444
   00350 Tyrosine metabolism
    101944444
   00360 Phenylalanine metabolism
    101944444
   00380 Tryptophan metabolism
    101944444
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    101944444
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     101944444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 Pyr_redox Pyr_redox_2 AlaDh_PNT_C Thi4 FAD_binding_2 FAD_oxidored HI0933_like MCRA Pyr_redox_3 Trp_halogenase C_GCAxxG_C_C 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 101944444
NCBI-ProteinID: XP_008174923
Position
Un
AA seq 534 aa AA seqDB search
MLAGPTYNCSNANNGSMRFLIFPELCLDDPDYDELVKIAENGLGKAAHPVEVVIVGAGIS
GLTAAKLLRDAGHMVTVLEASGRVGGRVRTYRDETQDWYVELGAMRLPSTHSIVRQFIRQ
FSLTLNKFSETDDNAWYLVNGVRTTAGNVKKNPDILSYTLAPSEKGKSAKELYKEILQKA
REKFQSTDCEKLLDRYDSFSTKEYLIKEGKLSHGAVQMIGDLMNEDAGFHMSFLNSLMEF
NIFFHEDGFDEITGGFDQLPLAFYRSMPGVVQLTCTVEQIKYIGNKVQVLYHSAHDICSP
SSVMADYVLVTATAKATRLIKFLPPLSSNKTHALRSIHYATATKVALACTEKFWEKDGIR
GGPSVTDRPSRFIYYPNHNFSSGVGVIVASYTWNDDAEFFLSMSDEKCIDVVLEDLAEIH
NKSTKYLRSVCNKHVIQRWNLDKHSMGAFASFTPYQFADYSGPLFQNEGRVHFAGEHTAQ
PHAWIDTAMKSAVRAARNIHLASNLSWGKHQLQKQQEQQEQKQERDDWVQRVEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaggtcccacttacaactgttccaatgccaacaatggttccatgagattcctc
atatttcctgaactttgccttgatgatcccgactacgatgagctggtgaagattgccgaa
aatgggcttggaaaggcagctcatccagtggaggtggtcattgtaggggcaggcataagt
ggactcactgctgccaaactgctcagagatgccggtcacatggttacagttctggaagcc
agtggtcgtgtgggaggacgagtcaggacctatcgagatgagacacaagattggtatgtg
gagttgggagccatgcgtttgccaagcacccacagtattgttcgtcaatttattaggcaa
ttctcccttacgctaaacaagttttctgagacggatgacaacgcctggtatttggttaat
ggtgtcaggacaacagctgggaatgtcaaaaagaacccagatatcttgagttatactctg
gctccctcagagaaaggcaaatctgctaaggaactttataaagaaattctgcagaaggcc
agagagaagttccagagcacagattgcgaaaagttgctggatcggtatgacagcttttcc
accaaggagtacttgattaaagaagggaaattaagccatggggctgtacagatgatcgga
gacttgatgaatgaggatgctggattccacatgtcatttcttaattctctcatggagttt
aatatcttctttcatgaagacggttttgatgagatcacagggggattcgaccaattgccc
ctggccttctaccggtctatgcctggagttgtccagctgacctgcacagtagagcagata
aaatacattggtaacaaggtccaagtattgtaccatagtgcacacgacatatgtagcccc
tcctcagtgatggctgactatgtccttgtcacagccacagcaaaagccacgagacttatc
aaatttctgccaccactttcctccaataagacccatgccctgcgctccattcactatgcc
accgctaccaaggttgccttggcctgcactgaaaagttctgggagaaggatgggattcga
ggtgggccatcagtcacagatcgtccttctagattcatctactatcccaaccacaatttc
tctagtggggtgggggtgattgtggcttcctacacgtggaacgacgacgctgaattcttt
ctttccatgagtgatgagaagtgcattgatgtggtactggaggacctggcagaaatccac
aacaaatccacaaagtatctccggtctgtctgtaataagcatgtgatacagagatggaac
ctggacaaacattccatgggagcatttgcctcattcaccccctaccagtttgctgactat
tccgggcctttgtttcagaatgaagggagggtccactttgcaggagaacacacagcccag
cctcacgcctggatcgacactgctatgaaatctgctgtgagagcagcaaggaacatccac
ttagctagcaatctgtcgtgggggaaacatcagctgcagaagcagcaagaacaacaagag
cagaagcaggaaagggatgactgggttcaaagagttgaactttaa

DBGET integrated database retrieval system