KEGG   Chrysemys picta (western painted turtle): 101945142Help
Entry
101945142         CDS       T04662                                 

Gene name
OXCT1
Definition
(RefSeq) 3-oxoacid CoA-transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00072  Synthesis and degradation of ketone bodies
cpic00280  Valine, leucine and isoleucine degradation
cpic00650  Butanoate metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101945142 (OXCT1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    101945142 (OXCT1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101945142 (OXCT1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     101945142 (OXCT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 101945142
NCBI-ProteinID: XP_005282219
Position
Un
AA seq 536 aa AA seqDB search
MGLACLLLIPVVPRVPHPLCDLLVMSMFLRLVNSCASTASSHRPRRARIFCLLQAGAHLE
CVDSMVNWAVELSNGELLGFGLCGIPENLIGGLLKTGVKGITAVSNNAGVDNFGLGLLLQ
TKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERVRAGGAGIPAFFTSTGYGTL
VQEGGAPIKYNKDGSIAIASQPREVREFDGRHYIMEKSITGDFALVKAWKADRAGNVIFR
KTARNFNQPMCKAAKITVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSI
RKPEDSKAKQKKEGDNVRERIIRRAALEFEDGMYANLGIGIPLLASNFISPDISVHLQSE
NGVLGLGPYPLENEVDADLINAGKETVTVLPGSSYFSSDESFAMIRGGHVDLTMLGAMQV
SKYGDLANWMIPGKMVKGMGGAMDLVSSAQTKVVVTMEHSAKGNVHKIMEKCNLPLTGKQ
CVNRIITEKAVFDVDKKKGLTLIEIWEGLSVDEIKKSTGCDFTVSPNLIPMRQIST
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggcatgtctgctgctgatccctgttgtacctcgtgtcccacatcccctgtgt
gatctgcttgtaatgtccatgtttctacggctggtcaatagctgtgcttccacagcctct
tcccacaggcccaggagagccagaattttctgtcttctccaagcaggagcccatctggag
tgtgtagacagcatggtcaactgggcagttgaactcagcaatggagagctgctaggtttt
ggattgtgtggaattccagagaacctcataggaggcttactgaagactggagtaaaaggg
ataactgcagtcagtaacaatgcaggtgttgacaattttggacttggtcttttgcttcaa
actaagcagataaaacggatggtatcatcctatgttggagaaaatgcagaatttgaacga
cagtacttatctggagaattggaagttgagcttacacctcagggtacgcttgctgagcga
gtccgtgcaggaggggcaggcattccagcatttttcacaagcacgggctatggaacgttg
gtacaagaaggaggagcacctatcaaatacaacaaagacggcagcattgccattgccagt
cagccaagagaggtgagggagtttgatggtcgtcactatattatggagaagtcaattaca
ggtgattttgcacttgtgaaggcatggaaggctgatcgtgcaggaaacgttatcttcagg
aaaactgcaagaaacttcaaccaaccgatgtgcaaagctgccaaaataactgtggtagag
gtggaagaaattgttgatataggatcatttgccccggaagatattcacattccaaagatc
tatgtccatcgtctcataaagggagagaaatatgaaaagagaattgaacgattatccatc
cgaaagcctgaagactcaaaagccaaacaaaagaaggaaggagataatgtgagagagagg
atcatcagacgagcagctttagagtttgaagacggcatgtatgctaatctgggcatagga
attccactgttggccagcaacttcatcagtccagacatttcagttcacctgcagagtgaa
aatggagtcctgggcttgggtccttatccacttgaaaatgaggtagatgcagacctgatt
aatgcaggtaaagagacagtcaccgttcttccaggttcctcctatttctctagtgatgaa
tcatttgcaatgattagaggaggtcatgtcgatttgacaatgcttggagcaatgcaggtg
tctaagtatggtgatctggccaactggatgatacctggtaagatggtgaaaggaatgggt
ggtgctatggacttggtgtctagtgcacaaaccaaagtagtcgtcaccatggagcactct
gccaagggcaacgtccacaaaattatggaaaaatgtaatttgccacttactgggaaacaa
tgtgtaaatcgtatcattacggagaaggctgtgtttgatgtggacaagaaaaaaggactg
accttgattgaaatctgggaaggactgtcagtggatgaaatcaagaaaagcactggctgt
gactttaccgtttcaccaaatctcataccgatgaggcagatttcaacctga

DBGET integrated database retrieval system