KEGG   Chrysemys picta (western painted turtle): 101946532Help
Entry
101946532         CDS       T04662                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101946532 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101946532 (MAP4K4)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101946532 (MAP4K4)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: STE group
  STE20 family
   101946532 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101946532
NCBI-ProteinID: XP_005304643
Position
Un
AA seq 1280 aa AA seqDB search
MINLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNV
LLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSC
GITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPS
TEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGE
PSSIVNVPGESTLRRDFLRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRI
EQQKEQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEEMERRRKEEEERRRAEEEKR
RVEREQEYIRRQLEEEQRHLEILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQA
YLLSLQHDHRRHQQQQQQQQERNKQSYHIPEPKSHYEPSERAREVDDRFRKTNQGSPEAQ
SKQTGKVLEPPVPSRSESFSNGNSEPVQPALQRPVEPQVQWSHLASLKNNVSPVSRSHSF
SDPSPKFAHHHLRSQDPYPPSRSEVLNQSSDSKSEVPDPTQKAWARSDSDEVPPRVPVRT
TSRSPVLSRRDSPLQSSGQQNNQAGQRNSTSNIEPRLLWERVEKLVPRPGSGSSSGSSNS
SSQPGSHPGSQSGSGERFRMRSSSKSEGSPSQRHENAAKKPEEKKEVFRPNKPAGEVDLT
ALAKELRAVEDVRPPHKVTDYSSSSEESGTTDEEDDDMEQEGADESTSGPEDARAVSTLN
LSNGETESVKTMIVHDDVESEPAMTPSKEGTLIVRQSTVDTKRASHHESNGFAGRIHLLP
DLLQQSHSSSTSSTSSSPSSSQPTPIMSPQTPQDKLTTNETQSASNTLQKHKSSSSFTPF
IDPRLLQISPSSGTTVTSVVGFSSEAMRSEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIR
KYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVL
VTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVI
ALKSSVEVYAWAPKPYHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDV
DSGSVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWG
EMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVR
SGGSSQVYFMTLGRTSLLSW
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgataaaccttgttatggaattttgtggagcaggctctatcacggaccttgtgaagaac
acaaaagggaacactctaaaagaagactggatagcgtatatctccagagagattctcagg
ggattggcacatcttcatgcccaccatgtgattcaccgggacatcaaagggcagaatgta
ctgttaacagaaaatgcagaggtgaagcttgtggattttggtgttagtgctcagctggac
aggacggttggcaggagaaacacatttattggaaccccatactggatggctccagaagtt
attgcctgtgatgaaaatccagatgctacttatgattacagaagtgacctttggtcatgt
ggcattacggccattgaaatggcagaaggagctccccccctctgtgacatgcatccaatg
agggcgctgtttcttatacccagaaaccctcctccacggctaaaatccaagaaatggtca
aaaaagttctttagttttatagaaggttgtttagtgaagaactatatgcagagaccctcc
accgagcagcttttaaaacatccttttatacgcgatcagccaaatgaacggcaagtccga
atccagcttaaggaccacatagacaggaccaggaagaagagaggagagaaagatgagaca
gaatatgaatatagcggaagtgaggaagaggaggaggaagtgcctgaacaagaaggagag
ccaagttcgattgtcaatgtgcctggagaatctaccctccgacgtgatttcctgagactg
cagcaggaaaacaaggaacgttcggaggcccttcggagacagcagctgctacaggaacag
cagctccgagagcaggaggagtacaagaggcagctgttggcagagagacagaaacgcata
gagcagcagaaagagcaaaggaggcggctagaagagcaacaaagaagagaacgggaagct
cgaaggcaacaagagcgtgagcagaggcgaagagaacaggaggagaaaagacggctagaa
gaaatggagaggaggcgtaaggaagaggaagagaggaggagagcagaggaagagaagagg
agagtggagagagagcaggagtatatcaggcgacagctagaagaggagcagcggcacttg
gaaattcttcagcagcagctgctccaggagcaggccatgttactggaatacagatggcga
gagatggaggagcatcgacaagcagagagactccagcgccagttgcaacaggagcaagcg
tatctcctgtcactgcagcatgatcataggcggcatcaacagcaacagcagcagcagcaa
gaaaggaataaacaaagctatcatatccctgagcctaaatcccattatgaaccttctgaa
agagcacgtgaggtggacgatagatttagaaaaactaatcaggggtcccctgaagcacag
tccaaacagacgggcaaagtgttggagccaccagtgccttcaagatcagagtccttttcc
aatggaaactcagagcctgttcagcctgcactgcaaagaccagtggaaccccaggtacag
tggtcccatctggcatctctcaagaacaatgtttcccctgtctcgcgatcccattccttc
agtgacccttctcccaaatttgcacatcaccatcttcgttctcaggacccatatccacct
tcacgcagtgaagtgctaaatcagagttctgactctaagtcggaggtacctgaccccact
caaaaggcttgggctagatcagacagtgacgaggtgcctccaagggtacctgtgagaaca
acgtccaggtctcccgtcctatcacgtcgagattctccactgcagagcagtgggcagcaa
aataatcaagcagggcaaagaaactccacaagcaatatagagcctcgtctgctatgggag
agggtggagaaacttgtgccgagaccaggcagcggcagttcctcgggctcaagtaactcc
agctcacagccggggtcccatcctggatctcagagtggctctggtgaacggttccgaatg
agatcatcatccaaatctgaaggttcaccgtctcaacgtcatgaaaatgcagccaaaaaa
cctgaagagaagaaagaagtcttcagacccaacaagcctgctggagaagtggatttaact
gccttggcaaaggaattgcgagctgtagaggatgtacgacctccacacaaggtgacagac
tattcatcgtccagtgaagagtcggggacgacagatgaggaggatgacgatatggaacaa
gaaggagcagatgaatctacatctgggccggaggatgccagagctgtatcaactctgaat
ctgagcaatggtgaaacagagtcagtgaaaaccatgattgtccatgatgatgtggagagt
gaacctgccatgacgccttccaaggagggtactttaatcgtccgacagagtacagttgac
acaaagcgtgccagccatcatgagagcaatggctttgccggtcgcattcacctcttgcca
gatctcttacagcaaagccattcctcctccacttcttccacctcctcctccccatcctcc
agccagccgacacccatcatgtccccacagacaccccaggacaagctaactactaatgag
actcagtccgctagtaacacactccagaaacacaaatcttcctcctcctttacacctttt
atagaccccagattactacagatttctccatctagtgggacaactgtgacttctgtggtg
ggattttctagtgaagccatgaggtcagaggcaataaggcaagatcccaccaggaaggga
tcagttgtcaatgtgaatcctactaatacacgaccacaaagtgacactccagagattcgc
aaatacaagaagagattcaattctgagattttgtgtgctgccttatggggagtgaatttg
ttagtgggaactgagagtggtctgatgctgctagacagaagtggtcaggggaaggtttat
cctctaataaaccgaagacggttccagcagatggatgtactcgaaggcctgaatgtcttg
gtgacgatatctggtaagaagaacaagttgcgagtttactacttgtcctggttaagaaat
aaaatcctacataatgatcctgaagtagaaaagaaacagggttggacaactgtgggcgac
ttggaaggctgtgtgcactataaagttgtaaaatacgaaagaatcaaattcttggtaatc
gctttgaagagttcggtggaagtctatgcatgggcaccaaagccataccacaaatttatg
gcctttaagtcatttggagaattggtacataagccattgctggtggacctaactgtagag
gaaggtcagaggctgaaggtgatctatggttcctgtgctggtttccatgctgttgatgtg
gactcaggatcagtctatgatatttatctgccaacacatatccagagcagcatccaacca
cacgcaatcattattctcccaaacaccgatggaatggagctgctggtttgctatgaggat
gaaggggtttatgttaatacctatgggaggatcaccaaagatgtggttctgcagtgggga
gagatgcccacatcagttgcatacattcgatccaatcagattatgggctggggagaaaag
gctattgagatacgatcagtggaaactgggcacttggacggcgtgttcatgcacaaaagg
gcacaaagactcaagttcttatgtgagcggaatgacaaggttttctttgcttctgtacgg
tctggtggaagcagtcaagtttatttcatgaccctaggcaggacttctcttctgagctgg
tag

DBGET integrated database retrieval system