KEGG   Chrysemys picta (western painted turtle): 101947074Help
Entry
101947074         CDS       T04662                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04270  Vascular smooth muscle contraction
cpic04350  TGF-beta signaling pathway
cpic04510  Focal adhesion
cpic04530  Tight junction
cpic04810  Regulation of actin cytoskeleton
cpic05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101947074 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101947074 (ROCK1)
   04530 Tight junction
    101947074 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101947074 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101947074 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101947074 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101947074 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpic03036]
    101947074 (ROCK1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101947074 (ROCK1)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101947074 (ROCK1)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101947074 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 FPP Cortex-I_coil Pkinase_C APH DUF1192
Motif
Other DBs
NCBI-GeneID: 101947074
NCBI-ProteinID: XP_005309555
Position
Un
AA seq 1377 aa AA seqDB search
MSTGENFEARFEKIDVMLRDPKSEVNGDCLLDGLDALVYDLDFPALRKNKNIDNFLNRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGQECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKDAKNLMCAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNHRYLSASAENSNDNRTSS
SIDKSLMENMQKTIYQLEEQLQNEMQLKDEMEQKCRTSNIKLDKLMKELDEEGNQRKHLE
STVSQTEKEKMLLQHKINEYQRKVEQENERRRNVENEVSTLKDQLEDLKKISQHSQTTNE
KMTQLQKQLEEANDLLRTESDTAARLRKSHTEMSKSISQLESLNRELQERCRVLESTKLE
VEKDYYQLQAALEAERRDRSHGSEMIGDLQARITSLQEEVKNLKNNLERVEAERKQARDS
LNHCEKEKNNLEIDLNYKLKTLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEK
KVKEERAARDRAENQIVQIEKQCSMLDFDLKQSQQKLEHLTEQKERFEDEVKSLTFQLEQ
EINKRQMTQNELKTQAFEADNLKGSEKQLKQEINTLLEAKRLLEFELAQLTKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNKETQRKIQELQNEKETLAAQLDLAETK
AESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDNIVSRLEETNKTLTTDVESLTKE
NAELMEKNKKQEEEFKLKKEDEINTIRMHYEKNLHTERTLKTQAVNKLAEIMNRKDFKID
RKKANIQDLRKKEKENRKLQLELNQEKEKYNQMVVKYQKELNEMQAQLVEELTYRNELQM
QLDSKESDIEQLRSKLLDLQQGMDSTSVASLQPDETDGNLTESRIEGWLSIPNKGNIKRH
GWKKQYVVVSSKKILFYNDEKDKDLSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEGEPAQTMEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
PALECRKCHVKCHKDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKKI
PKTPPSGFIRASPRTLSARSSANQSFRKVVKNASGKTRSKDCGSMGESTLSENSSYC
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaggagaaaactttgaggctcggtttgaaaaaatcgatgtgatgttaagggac
cccaaatctgaagtgaacggtgactgcttactggatggattagatgctttggtgtatgat
ttggattttcctgccttaagaaaaaacaaaaatatagacaactttttaaacagatataaa
gacacaattaataaaatcagagatttgcgcatgaaagctgaagattatgaagtggtgaag
gtgattggcagaggtgcatttggggaagttcagttggtaaggcataaatcttcaaggaag
gtgtacgctatgaaactgctgagcaagtttgagatgataaaaagatcagattctgcattc
ttttgggaagaaagggacattatggcttttgctaatagcccctgggttgttcagttattt
tatgcattccaagatgaccgttacctttacatggtgatggaatatatgcctggtggggac
cttgtgaatttaatgagcaactatgatgttcctgagaaatgggcaagattttatactgca
gaagttgttcttgcgttggatgcaattcactcaatgggctttattcacagagatgtgaag
cctgataatatgctgctggataaagctggtcatttaaaactagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagctgttggaacaccggattat
atttctcctgaagtattaaaatcccagggtggtgatggttactatggacaagaatgtgac
tggtggtcagttggggtctttttgtatgaaatgcttgttggtgatacacctttttatgca
gattccttggttggaacatatagtaagattatgaaccataagaattctcttaccttccct
gatgataatgatatctctaaagatgcaaaaaaccttatgtgtgccttcctaactgacagg
gaagtgaggttaggacgaaatggtgtagaagaaatcaagcgacacctcttcttcaaaaat
gatcagtgggcttgggaaactcttcgagacactgtagcaccagttgttcctgatttaagt
agtgatattgacactagtaacttcgatgatttggaagaagacaagggagaggaagaaaca
ttccctataccaaaagcatttgttggcaaccagctaccttttgtaggatttacatactac
agcaaccatcggtatttatctgcctccgcagaaaattcaaatgacaacagaacaagttcc
agtatagataaaagcctgatggaaaatatgcagaaaactatctatcagttagaagagcag
cttcaaaatgaaatgcaattgaaagatgaaatggagcaaaaatgcaggacttcaaacata
aaactagacaagctaatgaaggaactggatgaagagggaaatcaaagaaaacatttagaa
tcaacagtatctcagactgagaaggaaaagatgctgctgcaacataaaataaatgaatac
caaagaaaagttgaacaggagaatgaaagaagacgaaatgtagaaaatgaagtgtccacc
ttaaaagatcagttagaagacttgaaaaaaattagccagcattcacaaactacaaatgag
aagatgacacagttacaaaagcaactagaagaagccaatgacttactaaggacagaatca
gatacagcagcaagattgagaaagagtcatacagaaatgagcaagtccataagccagtta
gaatcactaaatagagaacttcaggaaagatgcagagttctagagagcacaaaattggaa
gtggaaaaggactattatcaattgcaagcagcactggaagcagaacgaagggacagaagt
catggatctgaaatgattggagatttacaagctcggattacatctttacaagaagaagta
aaaaatcttaaaaataatcttgaaagagtggaagcggaaagaaaacaggcacgagactca
cttaatcattgtgaaaaggaaaagaataacttagaaatagatttaaactataaactcaaa
acattacaacagcggctggaacaggaggtaaatgagcataaagtgactaaagctcggtta
actgacaaacatcaatcaattgaagaggcaaaatcagttgcaatgtgtgaaatggaaaaa
aaagtgaaggaggagagggcagcaagagacagggcagaaaatcaaatagttcagattgaa
aaacaatgttccatgctggactttgacctgaagcagtctcagcagaagcttgagcacctc
actgagcaaaaggagaggtttgaggatgaagttaagagtctaacatttcaactggaacaa
gaaataaataagcgacaaatgacacagaatgaactgaaaacacaagcttttgaggcagac
aacttgaagggttctgagaagcagctgaaacaggagatcaatacattgttggaagcgaag
agattattggaatttgagttggctcaactcactaagcagtatagaggaaatgaaggtcag
atgcgggaacttcaggatcagcttgaagctgaacagtatttttcgacactttacaaaact
caggttaaggagcttaaagaagaaattgaggagaagaataaagaaactcaaagaaaaata
caggaattgcaaaatgaaaaagaaactcttgctgcacagttggatctggctgaaaccaaa
gctgaatcagagcagttggcccgaggtctcctggaagaacagtattttgaattgactcag
gagagcaagaaagcagcatcaagaaatagacaagaaattactgataaggacaacattgta
agccggctggaagaaacaaataaaacattaaccactgatgttgagtctctaacaaaagaa
aatgcagagctcatggaaaaaaataagaaacaggaggaagaatttaaattgaagaaagaa
gatgaaatcaacactattagaatgcattatgagaagaatcttcacactgaaagaactctt
aaaacacaggctgtgaacaaattggctgagataatgaatcggaaagattttaaaatagac
agaaagaaagctaatatacaagatttgaggaaaaaagaaaaggaaaaccgaaagctacaa
ctggagcttaatcaagaaaaagagaaatacaatcagatggtagtgaaataccagaaggag
ctcaatgaaatgcaagcgcaactagtagaagagttaacatacaggaatgagcttcagatg
cagctggatagtaaagagagtgatatagaacaattgcgtagtaaacttttggaccttcag
caaggaatggactctaccagtgttgccagcctccagccagacgaaactgatggaaacctt
acagagtcaagaattgagggttggctttcaataccaaacaaaggaaatataaaacgacat
ggctggaaaaagcagtatgttgtggtaagcagtaaaaagattttgttctataatgatgaa
aaggacaaggacctgtccaatccatccatggtactagatatcgataaactattccatgtc
cgacctgtaacccaaggagatgtatatagagcagaaactgaggaaatccctaaaatattc
cagattctgtatgctaatgagggtgaatgcaggaaagatttggaaggagaaccagcacag
acaatggagaaaacaaattttctaaatcacaaaggtcatgaatttattcctacattatac
cactttccagccaactgtgaggcctgtgccaaacccctctggcatgtctttaagccgccc
cctgccttggagtgtcgaaagtgccatgttaagtgccataaagatcacctagataaaaag
gaggaattaattgctccatgtaaagtgagttatgatgtaacttcagcaagagatatgttg
ttgttggcatcctgtcaggatgaacagaagaaatgggtcacgcatttagtaaagaagatc
cccaagacacccccatccggtttcattcgtgcttcccctagaaccctgtctgcaagatct
tctgcaaatcagtctttccgaaaagttgttaaaaatgcttctggaaaaactaggtcaaaa
gattgtggatctatgggggaaagtaccctttcagaaaactcaagttactgctaa

DBGET integrated database retrieval system