KEGG   Chrysemys picta (western painted turtle): 101948087
Entry
101948087         CDS       T04662                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cpic01002]
    101948087 (ERAP1)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101948087 (ERAP1)
Peptidases and inhibitors [BR:cpic01002]
 Metallo peptidases
  Family M1
   101948087 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101948087
NCBI-ProteinID: XP_005284101
Position
Un
AA seq 950 aa
MAALFSTLPFADKSSFMMMMMTIGVLNGAVSVNNDHNSKNRETADVVSGNGSKPFPWDKI
RLPKHVIPVHYDLLLHPNLTTLTFTGFARIEITVNQQTSSVILHSKHLQITRATIQRRMG
NSHTEKEVMVLEYPPFEQIALLAAFPLHVGQNYTVSIEYSANLSESFHGFYKSTYRTQEG
EVRVLASTQFEPTAARMAFPCFDEPSFKARFSIKIRREPKHLALSNMPIVKSVNVANWLV
EDHFDVSVKMSTYLVAFIVSDFKSVSKMTTSGIKISVYTVPDKINQADYALDAAVKLLDF
YENYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDPEKSSASAKLWITMIIA
HELAHQWFGNLVTMEWWNDLWLNEGFAKFMEYVSVSITHPDLKVEDYFLGKCFDAMEVDA
LNSSHPVSTPVEDPAQIQEMFDDVSYEKGACILNMLRDYLNADVFKAGLVQYLRKYSYQN
TKNEDLWNSLAHTCPVGDTQESQLQGDGFCTRNQQTSSSAHWTRREILDVTTMMNTWTLQ
KGFPLVTVTVKGKNVHLHQEHYMKGSDSSPSTGYLWHVPLTYITSKSDTVQRFLLTTKTD
VLILPEEVEWIKFNVGMNGYYIVHYEDDGWDALISLLKENHTAISSNDRASLINNVFQLV
SIGKLSISKALDLSLYLKHESQIMPVFQGMNELIPMYKLMEKRDMDDVENQLKGYIVNLF
KDLIDKQSWNDEGSVSERMLRSSLLLFACARKYQPCVDKAEEYFMKWKESNGTLRLPNDV
KTAVYAVGAQTIEGWDFLFSKYRLPWFNTERNQIEVALSISRNKDKLQWIMDQSLLGDVV
KTQDLPHIIVFVAKNPSGYHLAWKFLKENWNKLVQKFELGSPSIAHMVIGVTNQYSTREQ
LAEVKEFFNSLEEKSSQLRCVQQAVETIEENIRWMDINFEKIKIWLQNNM
NT seq 2853 nt   +upstreamnt  +downstreamnt
atggcagctttattctctactctgccatttgcagataaatcctctttcatgatgatgatg
atgacgataggtgttttaaatggtgcagtttctgtgaataatgaccacaatagcaagaac
agggagacagctgatgtagtgtctggcaatggaagcaaaccgtttccgtgggataaaata
aggcttcccaagcatgtcatcccagtgcattatgatctcctcctccatcctaatcttacg
actctaacttttactggatttgccagaatagagattacagtaaaccaacaaactagttca
gtcatcctgcacagcaaacacctgcaaattaccagggctaccatccaaaggagaatggga
aatagtcacacggaaaaagaagtgatggttttggaatatccaccatttgagcagattgcc
ctcctggcagcttttccactgcatgttggacaaaactacactgttagcattgaatattct
gcaaatctgtcagagagtttccacggcttttataaaagcacctatagaacccaggaagga
gaagtgagggtacttgcatcaacacagtttgagccaacagctgctcgcatggctttccca
tgttttgatgaaccatctttcaaagccagattttccattaagattaggagagaaccaaag
caccttgcactatctaatatgccaatagtgaaatctgtgaatgttgctaattggctagtt
gaagaccattttgatgttagtgtaaagatgagcacttatctagtggcctttattgtttcg
gattttaaatcagtcagcaagatgaccaccagtggaattaagatatcggtatatactgta
ccagacaagatcaaccaagctgattatgccttggatgcagcagtgaaacttttagacttc
tatgagaattacttcagcattccatatcccttacccaaacaagatctagctgctattcct
gattttcagtctggagctatggaaaactggggactgaccacatacagggaatcttctttg
ctatatgaccctgaaaagtcctcggcatcggctaaactttggattactatgataatagcc
catgagctggctcatcagtggtttggaaacctagttaccatggaatggtggaatgatctt
tggctaaatgaaggatttgcaaagtttatggagtatgtgtcagtcagtattactcatcca
gatctgaaagttgaagattattttttaggcaagtgttttgatgccatggaggtggatgca
ttaaattcctcacatcctgtgtctactcctgtggaagatccagctcaaattcaagaaatg
ttcgatgatgtttcctatgaaaagggagcttgtattctaaatatgttaagggattacttg
aatgcagatgtgtttaaagctggtcttgtacaatatctgcggaagtacagctatcagaat
acaaaaaatgaagatctatggaacagtctggcacatacttgtcctgtgggtgacacccag
gaaagccaactacaaggtgatggcttttgcaccagaaaccaacaaacatcttcaagtgca
cactggaccaggagagagattcttgatgtgacgacaatgatgaacacttggacattacaa
aagggttttccactagtaactgtcacagtaaaaggaaagaatgtccatctgcatcaagag
cactatatgaagggatcagattcttctccatcaacagggtacttgtggcatgttccatta
acgtacattactagtaaatctgacactgtgcaaagatttttgctgacaactaaaacagat
gtcctcatcctcccagaagaggtagaatggataaaattcaatgtgggaatgaatggttat
tacattgtgcactatgaagatgatggatgggatgctctgattagccttttaaaagaaaac
catacagcaattagcagcaatgatagagcgagtctcattaacaatgtattccagcttgtg
agtattggaaaactatcaatttctaaagctcttgatttatctttgtatttgaaacatgaa
tcccaaattatgcctgtattccaaggtatgaatgagctgattcctatgtacaagctcatg
gagaaaagggacatggatgatgtagaaaatcagttaaaggggtacatagtcaatctgttt
aaagacctaattgacaaacagtcctggaatgatgagggctcagtgtctgagagaatgctt
cgcagttccctactcctgtttgcgtgtgcgcgcaagtaccagccgtgtgtggacaaagca
gaagaatattttatgaaatggaaggaatccaatggaactttacgtttgcccaatgatgtt
aaaactgcagtatatgctgttggagcccagacaatcgaaggttgggacttcctttttagt
aaatacaggctaccttggttcaacactgagagaaatcagattgaagttgctctcagtatt
agcagaaataaggacaaacttcagtggataatggatcaaagtttgcttggtgatgtagta
aaaacccaggatcttccacatatcattgtgtttgttgctaaaaacccttctggctatcat
ctagcatggaaatttttgaaggaaaactggaataaacttgtacaaaagtttgaacttggc
tcaccttctatagcccacatggtaatcggagtgacaaatcaatattctacaagggaacag
cttgcagaggtgaaagaattcttcaattctctggaggaaaaaagttcacagctccgctgt
gtccaacaagctgtagaaaccattgaagaaaatatacgatggatggacataaactttgaa
aaaatcaaaatatggctacaaaataacatgtga

DBGET integrated database retrieval system