KEGG   Chrysemys picta (western painted turtle): 101948162Help
Entry
101948162         CDS       T04662                                 

Gene name
SLC29A3
Definition
(RefSeq) solute carrier family 29 member 3
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpic02000]
    101948162 (SLC29A3)
Transporters [BR:cpic02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   101948162 (SLC29A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran Peptidase_M56
Motif
Other DBs
NCBI-GeneID: 101948162
NCBI-ProteinID: XP_005281928
Position
Un
AA seq 484 aa AA seqDB search
MAVDLEDGDDRFQHSANSAYKPVNTSFQEEEPLIEEPVGNRYSLQKPKDHLNGAYVIFFI
LGIGSLLPWNFFITAKQYWIYKLQNCSNQQEPKGHGVSDLRDYFESYISIASTVPSVLCL
IGNFVLVNRVSASIRILSSLAVMLAVFVVITVLVKMDTSTWTQRFFVITIVCVVIVSSAS
TIFSSSIFGLTGCFPMKNSQALISGQAMGGTVSAVASVVDLAAAADVTDSALAYFLTADV
FIIVCIVVYLILPKLEYSRYYMRSHKSSTHPAGVLPSSYLEGVDESKGITTSSFPAKATS
DQNIPPLRPILKKTAVLGFCVFYVFFISIIIFPSISSSIESVNKDSGSLWSNKYFIPLTS
FLLYNFADWCGRQITAWIQAPGPKSKLLPALVLLRTLSLPLFMLCNYQPRSHIKMVIFNK
DVYPAVFIVLLGLSNGYLGTLAIIYGPKILPKELAEATGVVMTFYLTLGLALGSACSILL
VHLI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgatttggaagatggagacgaccgatttcagcacagtgctaactctgcatat
aaaccagtgaatacctctttccaagaagaagagcctctgattgaggagccagtggggaac
agatacagtctgcaaaagccgaaggatcacttaaatggcgcctatgttatttttttcatc
ctgggtattggctctctgttgccttggaacttttttatcacagcaaaacaatactggata
tataaacttcagaactgctccaatcagcaggagccgaagggacatggagtctctgatctc
cgtgactactttgaaagttacatttccattgcctcaactgtgccttcagtgctctgcctg
attggaaactttgtgctagtcaacagggtatctgccagcatccgcattctgtcctccttg
gctgtcatgctggctgtcttcgtggtgatcactgtgctggtgaaaatggacacatccaca
tggacacagcgtttttttgtcataaccatagtttgcgtggttatagtcagcagcgcctcg
accatcttctccagcagcatctttggcctgacaggctgtttccccatgaagaattcgcag
gcgttgatttcaggtcaggccatgggaggcacagtcagtgctgtggcatcggtggtggac
ctggcagcagcagctgatgttacagacagcgccttggcctacttcctgacagcagatgtc
ttcatcattgtctgcattgtggtatacctgattcttcccaagttggaatactccaggtat
tacatgagaagccacaagagtagcacacacccagctggtgtattgcctagcagttattta
gagggagtggatgagtcaaaaggcatcaccaccagctcatttccagccaaagcgaccagt
gaccaaaatatcccacccctacgtcctatcctgaagaagaccgctgtcctgggcttctgt
gtcttctatgtctttttcatctctatcatcatatttccttccatctcctccagcatagaa
tctgtcaacaaggactcggggagcttatggagcaataaatacttcatccccctcaccagt
ttccttttgtacaattttgctgactggtgtggacggcaaatcaccgcctggatccaggcc
cctggcccaaagagcaaactgctccctgctctggtcctcctaaggactttgtcactaccc
ctattcatgttatgtaactatcagcctcggagccatatcaaaatggtaatcttcaacaaa
gatgtctacccggctgtcttcattgtgctcttaggactcagcaatggttacctgggtacc
ttagctatcatctatggccccaagatcttgccaaaagagttggcagaggcaacaggggtg
gtgatgacattttacctgacattaggattggcgttgggatctgcctgctcaattcttttg
gtccatctaatatag

DBGET integrated database retrieval system