KEGG   Chrysemys picta (western painted turtle): 101948174Help
Entry
101948174         CDS       T04662                                 

Gene name
PPIL3
Definition
(RefSeq) peptidylprolyl isomerase like 3
  KO
K12734  peptidyl-prolyl cis-trans isomerase-like 3 [EC:5.2.1.8]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpic03041]
    101948174 (PPIL3)
   03110 Chaperones and folding catalysts [BR:cpic03110]
    101948174 (PPIL3)
Enzymes [BR:cpic01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101948174 (PPIL3)
Spliceosome [BR:cpic03041]
 Complex C
  Other components
   PPlases
    101948174 (PPIL3)
Chaperones and folding catalysts [BR:cpic03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101948174 (PPIL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 101948174
NCBI-ProteinID: XP_005310373
Position
11
AA seq 161 aa AA seqDB search
MAVTLHTDVGDIKIEIFCERTPKACENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGSG
KGGNSIWGRKFEDEYSEHLKHSVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGK
VIDGLETLDELEKLPVNEKTYRPLNDVHIKDVTIHANPLAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcacactgcacactgatgtgggagatattaaaatagagatattctgtgagcga
acacctaaggcctgtgaaaacttcctggctctttgtgctagtaactactacaatggctgc
atatttcatcggaatatcaaaggattcatggtgcagacaggggatccaacaggctctggg
aaaggaggtaacagcatttggggcaggaaatttgaagatgaatacagtgaacacctaaag
cacagtgtccgcggtgtcgtttccatggcaaacaatggcccaaacaccaatggatctcag
ttcttcattacatatggcaaacagccacacctagatatgaagtatactgtctttgggaag
gtaattgatggtctggagaccctagatgagctggagaagctcccggtgaatgagaaaacc
taccgacctcttaacgatgttcacattaaggatgtcacaattcatgccaaccctttggct
tcatag

DBGET integrated database retrieval system