KEGG   Chrysemys picta (western painted turtle): 101948329
Entry
101948329         CDS       T04662                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00230  Purine metabolism
cpic00240  Pyrimidine metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101948329 (DCK)
   00240 Pyrimidine metabolism
    101948329 (DCK)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101948329 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 AAA_17 MMR_HSR1
Other DBs
NCBI-GeneID: 101948329
NCBI-ProteinID: XP_005304178
Position
Un
AA seq 256 aa
MATPPKRGRAQSGVKKIAIEGNIAAGKSTFVNILKQASQEWEVVPEPVERWCNVQNCQED
DEELTTSQKSGGNVLQMMYEKPDRWSFTFQTYACLSRIRAQLKSLNGKIREVENPVVFFE
RSVYSDRYIFASNLYESDCMNETEWTIYQDWHEWMNKQFGQSLQLDGIIYLRATPEKCLN
RIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFEYLEEVPILTLDVNEDFKGNKD
QYENMIEKVKEFLSTL
NT seq 771 nt   +upstreamnt  +downstreamnt
atggccaccccccccaagcgcggccgggcccagagcggcgtcaagaagatcgccatagag
ggcaacatcgctgcaggaaaatcaacatttgtgaatattctcaaacaagctagccaggaa
tgggaagttgttcctgagcctgtagaaagatggtgcaatgttcaaaactgccaagaggat
gatgaggagctgacgacgtcacagaaaagtggggggaatgtgctccagatgatgtatgag
aaaccggaccggtggtctttcaccttccagacgtatgcctgcctgagcagaatccgggct
cagctcaaatcccttaatgggaaaatcagagaggtggagaaccctgtagtcttctttgag
cgatctgtgtatagcgacaggtatatttttgcatctaatttatatgaatctgattgcatg
aatgagaccgaatggacaatttaccaagattggcatgaatggatgaataaacagtttggt
caaagccttcaactagatggaatcatttatctcagagccactcctgagaaatgcttaaat
aggatttacttgcgtggaagagatgaagaacaagaaattcctattgaatatctggagaaa
cttcactacaaacatgaaagctggcttcagcatagaacattgcggactgattttgaatac
ctggaagaagtacccatcttaacactggatgttaatgaagatttcaaaggcaacaaagac
cagtatgaaaatatgattgaaaaggtcaaggaatttttgagcactttataa

DBGET integrated database retrieval system