KEGG   Chrysemys picta (western painted turtle): 101948562Help
Entry
101948562         CDS       T04662                                 

Gene name
PLA2G4A
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00564  Glycerophospholipid metabolism
cpic00565  Ether lipid metabolism
cpic00590  Arachidonic acid metabolism
cpic00591  Linoleic acid metabolism
cpic00592  alpha-Linolenic acid metabolism
cpic01100  Metabolic pathways
cpic04010  MAPK signaling pathway
cpic04217  Necroptosis
cpic04270  Vascular smooth muscle contraction
cpic04370  VEGF signaling pathway
cpic04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101948562 (PLA2G4A)
   00565 Ether lipid metabolism
    101948562 (PLA2G4A)
   00590 Arachidonic acid metabolism
    101948562 (PLA2G4A)
   00591 Linoleic acid metabolism
    101948562 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    101948562 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101948562 (PLA2G4A)
   04370 VEGF signaling pathway
    101948562 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101948562 (PLA2G4A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101948562 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101948562 (PLA2G4A)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101948562 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 101948562
NCBI-ProteinID: XP_005290749
Position
8
AA seq 749 aa AA seqDB search
MSCIDPFQHITVEHQYSHKLTVTVLKATNVTKGAFGDMLDTPDPYVELFIPSAPDCRKRT
KHFNNNVNPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTSTFLISSLKLGEKKEV
PFTFNEVTEMILELFLEVCSSTDLRFSMALCDQEKMFRQQRRENIMHKMKTLLGSENSKN
LATSRDVPVIAVLGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSH
PDFPRKGPKEINEELMNCVSHNPLLLLTPQKVKRYIEALWNKKRSGQPVTFTDIFGMLIG
ETLIQNRMNTTLSKMKEKVNEAQCALPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMPPDLFGSKFFMGTVVKKHEENPLHFFMGVWGSAFSILFNRVLGVSNSHNKGPTMEEE
LENIRLKHLVSNDSSDSEDESQGPKGSENLEAAKELQSSSQESWVQRMLMALVGDSSLFN
TREGRAGKVHNFMLGLNLNTWYPLSPLAGLGTQESVEEDEMDTAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKEILLAEKWAKMN
NLPFPKIDPHVFDREGLKECYVFKPKNTDTEKDCPTIIHFVLANINFREYKAPGVPRETQ
KEKDFADFDIFDDPNTPFSTFNFQYSNEAFKRLHDLMEFNTLNNLDVMKQAIVESIEYRR
QNPSRCSVSLSNVEARKYFNKNSPSTNHT
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtatagatccatttcaacatattacagtggaacaccagtattcgcacaaatta
actgtgacggtattgaaagccacaaatgttacaaaaggggctttcggtgatatgcttgac
actccagatccatatgtggagctgttcatcccctcagcacctgactgcagaaagagaacg
aaacacttcaacaataatgtgaaccctgtatggaacgagacctttgagtttattttggac
ccgaaccaggaaaatgttctggagatcacattaatggatgccaactatgtcatggatgag
actcttggcacatcaacatttcttatatcctctctgaaactgggggagaagaaagaagtt
ccatttacttttaatgaagtcacagaaatgattttggaattgtttcttgaagtctgctct
tcaactgacctccggttcagcatggctctgtgtgatcaggagaagatgtttcgacagcag
cggagggagaatatcatgcacaaaatgaaaactcttttaggatcagaaaacagcaagaac
ttggccacttcccgcgatgtaccagtgatagcggtgttgggttcaggtggtggatttcgt
gccatggtagggttttctggagttatgaaagcactctatgaatcaggaattttagactgt
gcaacatatattgctggtctatctggatctacatggtacatgtcaactttgtattctcac
ccagatttcccaaggaaaggaccaaaggagattaatgaagaattgatgaactgtgtcagt
cataacccacttctgctgctcactccacagaaagtcaaacgctacattgaagcattatgg
aataagaaacgttctgggcagcctgtaacattcactgatatctttggaatgttgataggg
gaaacacttatccaaaataggatgaataccactttgagcaagatgaaagagaaagtcaat
gaggcacagtgtgctctgccactctttacttgtctccatgtcaaacctgatgtgtcagaa
cttatgtttgcagattgggtggaattcagtccatatgagattggtatggcgaagtatggc
acatttatgcctcctgatttgtttggaagtaaattttttatgggaacagtggtgaaaaaa
catgaagaaaaccccctgcacttcttcatgggcgtctggggcagtgcattttctatatta
tttaacagagtacttggagtttccaattctcataataaaggtcccaccatggaggaagaa
ttagaaaacattagactaaaacatcttgtgagcaatgatagttcagacagtgaagatgaa
tcacagggaccaaaaggctctgaaaatcttgaggctgcaaaagaacttcaaagtagcagt
caagaaagctgggtccagcgcatgctgatggccttggtgggagatagttcccttttcaac
accagagaagggcgtgctgggaaagtacacaactttatgctgggcttgaacctcaacaca
tggtacccactctcccctctagcaggcctgggtactcaggaatctgtggaggaggatgaa
atggacacggcagtcgcagatcctgatgagtttgagaggatatatgagccactagatgtg
aagagtaaaaagattcatgtagtggatagtgggctcacctttaacctgccataccccctt
atcttaagacctcagcgaggtgttgatctcataatctcctttgatttctctgcaaggcca
agtgactccagtcctcctttcaaagaaattttgcttgctgaaaaatgggccaaaatgaac
aaccttccttttccaaaaatagatccacatgtgtttgatcgagagggcctgaaggagtgc
tatgttttcaaacccaagaatactgatacagagaaagactgtccaaccatcatccacttt
gttctggcaaacatcaacttccgggaatacaaagctccaggtgttccaagagaaactcag
aaagagaaggactttgctgacttcgatatttttgatgatcctaatacgccgttctctacc
ttcaacttccaatattccaatgaagctttcaaaaggcttcatgatctaatggaatttaac
actctgaataacttagacgtgatgaagcaagcaatagtggaaagcattgaatacagaaga
cagaatccatcccgctgctctgtgtccctcagcaatgttgaggcaagaaaatacttcaac
aagaactctccaagcactaaccatacatag

DBGET integrated database retrieval system