KEGG   Chrysemys picta (western painted turtle): 101948563Help
Entry
101948563         CDS       T04662                                 

Gene name
QSOX1
Definition
(RefSeq) quiescin sulfhydryl oxidase 1
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101948563 (QSOX1)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     101948563 (QSOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_SOX QSOX_Trx1 Evr1_Alr Thioredoxin OST3_OST6
Motif
Other DBs
NCBI-GeneID: 101948563
NCBI-ProteinID: XP_008164821
Position
8
AA seq 737 aa AA seqDB search
MAGRRCHPHALLLLLLAATLAGAPPGGLYSPGDPLVLLQVDTLESSVLNSSSAWLVEFYA
SWCGHCVHFAPTWRALAADIQEWSPAVNVGVVDCADIANQKTCGKFGITGFPTLKFFKAF
SKSPEDGTKIFHPGDSIQNLRQSIITNLEMHKESWPPACPPLEPASMEEIRGFFQTNNVT
YLVLIFETNDSFLGREVTLDMLQYENIAVRRVLSSEEELVKKYGVTAFPSSFLLINNGTF
SRIPVQMEARSFYTHFLRRLPGVTRGLYTPTRAPDTPIKTTPTPRRPADRSNVYMADLES
ALHYALRVEVARFSVLTGERVRALKDFVAVLAKYFPGRPFVRNFLHSVDRWLRNVRESRI
PYSALELVLTNRKEGQAPAVLSNNVTWVGCQGSEPHFRGYPCSLWTLFHLLTVQATRHRR
LGTGPLEVLGAMRGYIQSFFGCRECAQHFEGMAAESMDKVRSVDEAALWLWSRHNRVNAR
LAGTETEDPQFPKLQWPPPELCRPCHSVVKRRQVWDEAAVLQFLKAYFSPINIFLNYTEP
ETALVVRRSREAKEGAGEWAMERRPGKLEGAGLGMEVGGSERRGFSGPRKPSIVRMNPKM
QELEEDIVDLDSFSELHYKSKALKAAANKGRRLSKRDTIPLLLADDSHQAFDYAAVWERL
RRRGLGSKQLIGALEEDEGDTLRRSHWFRMLGVGFSRLDVSLCIILYFLSSMCLLGMYTF
FRMRTRHRKGRPSFPTA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcgacgctgccacccgcacgcgctgctgctgctgctcctggcggccaccctg
gccggggcgccgcccggcggcctctactcgcccggcgacccgctggtgctgctgcaggtg
gacacgctggagagcagcgtcctcaactccagcagcgcctggctggtggagttctacgcc
tcctggtgcggccactgcgtccacttcgcccccacctggcgggcgctggccgccgacatc
caggaatggagtcccgcggtgaacgttggcgtcgtcgactgtgcagacatagccaatcag
aaaacgtgcgggaagtttgggataactgggttccctacgttgaagtttttcaaggccttc
tccaagagccctgaggacgggacgaagatattccatcctggggacagcattcagaacctg
aggcagagcatcatcaccaacctggagatgcacaaggagtcgtggccacctgcctgtcca
ccactggaaccagccagcatggaggagatccgtgggttctttcaaacaaacaatgtcacg
tacctggtgctgatcttcgagacgaacgactcctttctgggcagagaggtgacgctggac
atgctgcagtacgagaacattgctgtccggagagtgctgagcagcgaggaggagctagtg
aagaagtatggcgtgactgccttcccttccagcttcctgctcatcaacaacgggaccttc
agccgcatccctgtgcaaatggaggcgcgatccttctacacccacttcctgcggaggctg
cctggggtcacgcgaggcctctacacgccgaccagggcaccagacacaccgatcaagacg
acccccaccccacggaggcctgcagaccgctcaaacgtgtacatggctgacctggagtcc
gcgctgcactatgccctgcgggtagaggtggcccggttctctgtcctaacgggagagcgg
gtgagggccctgaaggactttgtggcagtgttggctaagtattttcctggccgccccttt
gtccggaacttcctgcactctgtggacaggtggctgagaaacgtgagagaatcaaggatt
ccctacagtgccttggagctggtcttgaccaacagaaaagagggtcaagccccggcagtg
ctgtcgaacaacgtgacgtgggtgggttgccaaggaagcgaacctcatttccgaggctac
ccctgctccctctggaccctcttccacctcctgacagtgcaggcgactagacaccgcagg
ctgggcacaggcccgctcgaggtccttggcgctatgcgcggctacatccagtccttcttt
ggctgccgggagtgcgcacagcactttgagggcatggcagcggagtccatggacaaagtg
agaagcgtggacgaggcagccctctggctttggtcaagacacaaccgggtcaacgctcgg
ctggcaggtaccgagacagaggacccccaattccccaagctgcagtggcctcccccggaa
ctatgccgtccatgtcacagtgtggtcaaaaggcgccaagtgtgggacgaggcagccgtg
ctgcagttcctcaaggcctacttttccccgatcaacatcttcttaaattacacggagccc
gagacggctctggtggtcaggcgcagccgggaggcaaaggagggagctggagagtgggcc
atggaaaggagaccagggaaattggagggtgcagggctgggaatggaggtgggtggctcg
gagagacgaggcttttcggggccacggaagccaagcatagtccggatgaaccccaagatg
caggagctggaggaggacattgtggacctggactccttcagcgagctgcactacaagagc
aaagccctgaaggctgcggccaacaaggggcggcggctgagcaagagggacaccatcccg
ctgctgctggcggacgacagccaccaggcctttgactatgctgcggtctgggagcgcctg
aggcggcgggggctgggctccaagcagctcatcggggccctggaggaggacgaaggggac
accctgaggaggagccattggttccgcatgctgggagtgggcttctcccgtctggacgtc
agcctgtgcatcatcctgtacttcctctcctccatgtgcctgttgggcatgtacaccttc
ttccgcatgcgcacgaggcaccgcaagggccgccccagcttccccacggcgtga

DBGET integrated database retrieval system