KEGG   Chrysemys picta (western painted turtle): 101948678Help
Entry
101948678         CDS       T04662                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00020  Citrate cycle (TCA cycle)
cpic00640  Propanoate metabolism
cpic01100  Metabolic pathways
cpic01200  Carbon metabolism
Module
cpic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101948678 (SUCLG1)
   00640 Propanoate metabolism
    101948678 (SUCLG1)
Enzymes [BR:cpic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101948678 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101948678 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101948678
NCBI-ProteinID: XP_005292516
Position
Un
AA seq 336 aa AA seqDB search
MSMPCQAIQHEWQPSVGTLDGTVQQNGVRHCSYSATRKNLYINKNTKVICQGFTGKQGTF
HSQQALEYGTKLVGGISPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAIN
EAVDAEIPLVVCITEGIPQQDMVRVKHKLIRQDKTRLVGPNCPGVINPGECKIGIMPGHI
HKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSFCVGIGGDPFNGTNFIDCLDVFLKDPQTE
GIILIGEIGGNAEEDAAAFLKENNSSPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGG
AKEKIAALQNAGVVVSMSPAQLGSTIHKEFEKRKLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgccttgtcaggcaatccaacatgagtggcagccctcagtgggcactttagat
ggtacagtgcagcagaatggagtacgtcactgttcctattcagccacacggaaaaatctt
tatatcaataaaaatacaaaggttatctgtcagggttttactggcaaacagggcaccttt
catagccaacaggcattggaatatggcaccaaactagtaggtggaatttccccagggaag
gggggcaaaactcatctgggcctgccagtctttaacaccgtgaaagaggctaaagaacaa
acaggtgccactgcctccgttatatatgtgcctcctccatttgctgctgctgcaattaac
gaagctgttgatgcagaaatccccttagttgtgtgcattacagaaggtattccacagcag
gatatggttcgggttaaacataaactgatccgtcaggataagactcgactagtgggccca
aattgccctggagtcatcaatcctggagaatgcaaaattggtatcatgccaggccacatt
cacaagaaaggaagaattggtattgtgtcaaggtctggcaccctaacgtatgaagctgta
catcagacgacgcaagttggattgggacagtccttctgtgttgggattggaggagatccc
ttcaatggaactaattttattgactgtcttgatgtcttcctgaaggatccccaaacagag
gggataatattgattggtgagattggaggcaatgctgaagaagatgcagcagcgttcttg
aaggaaaataattccagtccaaatgccaagcctgtagtgtcattcatagctggtctgact
gctcctcctggcagaagaatgggtcatgctggggcaatcattgctgggggaaaaggtggc
gctaaagagaaaattgctgctcttcaaaatgctggcgttgttgtcagtatgtctcctgct
cagctgggtagcactatacacaaggagtttgagaagaggaaactgctgtaa

DBGET integrated database retrieval system