KEGG   Chrysemys picta (western painted turtle): 101949587Help
Entry
101949587         CDS       T04662                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04020  Calcium signaling pathway
cpic04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101949587 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101949587 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cpic04030]
    101949587 (HTR4)
G protein-coupled receptors [BR:cpic04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101949587 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 101949587
NCBI-ProteinID: XP_005298068
Position
Un
AA seq 386 aa AA seqDB search
MEELDVNVSSSEGFGVAEKIALLTFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDNWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWTIPTFISFLPIMQGWNSIGILDLIQQRQFNKASN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYITAREHARQIRILQRAGAPTEGRH
HPDQHSSHRMKTETKAAKTLCIIMGCFCLCWAPFFITNVVDPFINYTVPEQLWTAFLWLG
YINSGLNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHVLRYT
VLHNGHHQEHEKLPIHNDPESQESCF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacttgatgttaatgtgagttcgagtgaggggttcggcgtggcagagaagatc
gcactgctcacctttatctcggcggttatactcatggcgatcctggggaacttgctggtg
atggtggcagtatgcagagacaggcagctcaggaaaatcaagaccaattatttcattgtc
tcacttgcctttgcggacctgctggtgtcggtgctggtgatgccctttggagctattgag
ctggttcaggataactggatttatggagagatgttctgcctggtccgaacatctctagat
gtcctgctcaccacagcatcaatccttcacctgtgctgtatctccctagacaggtactat
gctatctgctgccagcctctggtttacaggaataagatgacaccactgcgcattgctcta
atgcttggagggtgctggaccatcccgacatttatttcttttctccctataatgcaaggc
tggaattccattggtatattagacttgatacaacaaagacagttcaacaaggcttccaac
tcaacctactgcgtgttcatggtcaacaaaccctacgccatcacctgctcagtggtggcc
ttctacattccattcctcttgatggtgctggcctactatcggatttacatcacggccagg
gagcacgcccgccagatccggatcctccagcgtgcaggggcgcccacagaggggagacac
cacccggatcagcatagctctcaccgtatgaagacagagaccaaagctgccaagaccctg
tgtatcatcatggggtgcttctgtctgtgctgggccccattctttatcactaatgtcgtg
gacccgttcataaattatactgtacctgagcagctgtggacagctttcctgtggttgggc
tacatcaattcagggttgaaccccttcctgtatgccttcctgaacaagtctttcagacgt
gccttcctcatcattctgtgctgtggagacgaacgctaccgaaggccttccatcttgggg
caaactgtcccctgttccaccaccactataaatggatcgacgcacgtgctaaggtacaca
gttttacataatgggcatcatcaggaacacgagaagcttcccatccacaatgacccagaa
tcccaggagtcctgtttctaa

DBGET integrated database retrieval system