KEGG   Chrysemys picta (western painted turtle): 101951265Help
Entry
101951265         CDS       T04662                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04010  MAPK signaling pathway
cpic04060  Cytokine-cytokine receptor interaction
cpic04068  FoxO signaling pathway
cpic04210  Apoptosis
cpic04217  Necroptosis
cpic05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101951265 (FASLG)
   04068 FoxO signaling pathway
    101951265 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101951265 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101951265 (FASLG)
   04217 Necroptosis
    101951265 (FASLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101951265 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpic04147]
    101951265 (FASLG)
   04052 Cytokines and growth factors [BR:cpic04052]
    101951265 (FASLG)
   04090 CD molecules [BR:cpic04090]
    101951265 (FASLG)
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101951265 (FASLG)
Cytokines and growth factors [BR:cpic04052]
 Cytokines
  Tumor necrosis fators
   101951265 (FASLG)
CD molecules [BR:cpic04090]
 Proteins
  101951265 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF SNARE GutM Tweety RskA
Motif
Other DBs
NCBI-GeneID: 101951265
NCBI-ProteinID: XP_005304380
Position
Un
AA seq 305 aa AA seqDB search
MSRSLTARVMQAYKGRAGFPPGAQSAAGTAGFSSRMKEEFHSQGGPAIPLPTMQQNLNYV
YPQIFWVDSCASPTCAPSAPIATCPPPVPERRRRKQSNKRDGTCLCFLVVVLLVLLALAG
VGLGMFQIVQLQKELAELRELTSTGHVPSSMEKRIGLPNVTAEKKVIRKAAHLTGKADQK
TLPLEWVATLGHAFTSNIQYRHRSLVINETGLYFVYSKVFFRGKICNNLPLDHMVFKQNP
AYPASQVLMEDRKMNYCAAGKMWARGSYLGALFNLTKSDSLYVNVSETALVNFEESKTFF
GLYKL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagtagatctctcactgctagggtgatgcaggcgtataaaggcagagccggcttccct
cctggggctcagtctgcggctggcacagccggatttagcagccgcatgaaagaggagttc
catagccagggcggcccagccattccactgcccaccatgcagcagaacctgaattatgtc
tacccccagatcttttgggtggacagctgtgccagtcccacttgtgctccatcggcgccc
attgccacctgcccgccacccgtgccggagaggaggaggagaaaacagagcaacaagagg
gatggcacatgcctctgtttcttggtggtggttttgctggtcctgctggccctcgctgga
gtggggctggggatgtttcagattgtccagctgcagaaggaactggctgagctccgagag
ttaaccagcactggacatgttccttcgtctatggagaagcgcataggacttccgaatgta
acagcagagaagaaggtgatcaggaaggcagcacatttaacaggcaaagctgatcagaaa
acccttcctctggaatgggtggccaccctcgggcatgccttcacctccaatattcaatac
agacaccgcagcctggtgatcaatgaaacaggcctatactttgtgtactccaaggtgttc
ttccgaggcaagatctgcaacaacctgcccttagaccacatggttttcaaacaaaatcca
gcctacccagctagccaggtgctgatggaggacagaaagatgaactactgtgcggctgga
aagatgtgggccaggggcagctacctgggggcattgttcaacctcaccaaatcagacagc
ttgtatgtcaacgtctccgaaacggctctggttaattttgaggaatccaagacatttttt
ggtttatataaactttag

DBGET integrated database retrieval system