KEGG   Chrysemys picta (western painted turtle): 101953314Help
Entry
101953314         CDS       T04662                                 

Gene name
GUCY2F
Definition
(RefSeq) retinal guanylyl cyclase 2
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00230  Purine metabolism
cpic01100  Metabolic pathways
cpic04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101953314 (GUCY2F)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    101953314 (GUCY2F)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101953314 (GUCY2F)
Enzymes [BR:cpic01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101953314 (GUCY2F)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   101953314 (GUCY2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like CDC13_N
Motif
Other DBs
NCBI-GeneID: 101953314
NCBI-ProteinID: XP_005314788
Position
Un
AA seq 786 aa AA seqDB search
MPPAWFGFHRFLLRLSNHPRWGRRRPQAPLLWLLLLGWPAWVQPATFKVGVMGPWTCDPI
FAQALPEVAAQLAIGRLNRDPTMNQGYWFDYMLLNEECQTSQVLVALVNAERYASGFVGP
LNPGACGAAGLLGRAWNKPVFSWACLNGDAEVERWGTFARPLPRASSVLYAVLKFFRWAH
VAVVTSRQDLWVEVGQGLASSLREFGLPVGVVTTMEPGADGAWNALRKVQRADNVRVVVM
CMHSVLLGGEEQRLLLEKAEDLRMTDGTFVFIPYDALMYSLPYRRTPYPVLGNNTKLRLA
YDAVLTVTIDAPERSFREAFQDAQQAHELPAHLDPTQVHPLFGTIYNSIYYLAKAVERTR
QASRWVMGSSIAEHARDFQLDGFCQPLAADEDGDPMVSYIILDTDGKGNRLWPTYSVATG
PEGLRYMGHTIHWPHSASPSSDSSCWFDPTSVCSGGVDPSFILLLFILVSSLIVGGTILA
YYIRRRILHAQLMKGPNKIILTMDDLTFIHTQSSNKMDDSRTSLAGKSVSDMRSFKSLAA
APDNTNVAVAEGDEKQKCNSHVPFLLLLFNNQGLVAAVQGMKYLHHRDVVHGRLKSRNCV
VDGRFVLKVTDHGYNELLEAQKIPHDPPRPEERFWTAPELLRDPTLERKGTFRGDVYSIS
IIMQEVICRSAPYCMLDMPADEIIRKVEKPPPLCRPSVSVDQAPLECIQLMKQCWSEQPE
RRPTIDQIFDQFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTDKLL
TQMLPP
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccgcctggtttggcttccacaggttcctgctgcgcctctccaaccaccccagg
tggggacgacggcggccccaggctcccctgctctggctcctgctcctgggctggcccgcc
tgggtccagccggccaccttcaaggtgggggtgatggggccctggacctgtgaccccatc
ttcgcccaggccttgcccgaggtggctgcccagctggccattgggcggctcaacagagac
cccaccatgaaccagggctactggtttgactacatgctgctgaacgaggagtgccagacc
agccaggtgctggtggccttggtcaacgccgagcgttacgcctcgggcttcgtggggcca
ctcaacccaggggcctgcggggcggccgggctgctgggccgggcctggaacaagcctgtc
ttctcctgggcctgcctgaacggggacgccgaggtggagcggtggggcacctttgcccgg
cccctgccccgggcctcgtccgtcctctacgctgtcctcaagttcttccgctgggcccac
gtggctgtggtcacctcccggcaggacctgtgggtggaggtggggcagggcctggccagc
tccctgcgtgagtttggcttgcccgtgggcgtggtgaccaccatggagcccggggctgat
ggggcttggaatgccctgcggaaggtgcagagggccgataatgtcagagtggtggtgatg
tgcatgcactcggtgctgctgggtggggaggagcagcgcctcctgttggagaaggccgag
gacctgcgcatgacggacggcaccttcgtcttcatcccttacgatgcgctgatgtacagc
ctgccctaccgccggactccctaccctgtactgggtaacaacaccaagctgcggctggcc
tacgacgccgtgctcaccgtcacaatcgatgcccctgagcgcagcttccgcgaggctttc
caggacgcccagcaggcgcatgagctgccggctcacctggaccccacgcaggtgcacccg
ctcttcggcaccatctacaactccatctactacctggccaaggcggtggagcgcactcgt
caggccagccgctgggtgatgggctccagcatcgccgagcatgcccgggacttccaactg
gatggcttctgccagccgctggcggccgacgaggacggcgaccccatggtgagctacatc
atccttgacacagatggcaaaggcaaccgtctctggcccacctacagcgtggccacgggg
cccgaggggctgcgctacatggggcacaccatccactggccccacagtgccagccccagc
tccgactcgagctgctggttcgacccaacgtccgtctgttccgggggggtggaccccagc
ttcatcctgctcctgttcatcctggtttccagcttgattgttgggggaacgattcttgct
tactacatcaggcgccggatcctgcatgcccagctgatgaaggggcccaacaagatcatt
ctgaccatggatgacttgaccttcatccacacccagagcagcaacaaaatggacgacagc
cgcaccagcctggcggggaagagcgtctccgacatgaggagcttcaagagcctggcagct
gcccccgacaacaccaacgtggctgtcgctgagggagatgagaagcaaaaatgcaacagc
cacgtccccttcctcctccttttgtttaacaaccaagggctagtggcagccgtgcagggg
atgaagtacctccatcaccgggacgtggtccatggacggctgaaatcacggaactgcgtg
gtggatgggcgctttgtgctgaaggtgacggaccacggctacaatgagctcctggaggcc
cagaagatcccacatgacccacccaggcctgaagagcggttctggacggcaccggagctg
ctgcgggacccgacgctagagcgcaagggcaccttccgtggggacgtctacagcatctcc
atcatcatgcaggaggtgatctgccgcagtgccccctactgcatgctggacatgccggcc
gatgagatcatccggaaggtggagaagccgcccccgctgtgccgtccctcggtctcggtg
gaccaggccccgctggagtgcatccagctgatgaagcagtgctggagcgagcagcctgag
cggcggccgaccattgaccagatctttgaccagttcaagaacatcaacaaaggccggaag
accaacatcatcgactccatgctgcgcatgctggagcagtactccagcaacctggaggac
ctgatccgggagcggacggaggagctggagatcgagaagcagaagacggacaagctgctc
acccagatgttgccaccgtga

DBGET integrated database retrieval system