KEGG   Chrysemys picta (western painted turtle): 101953870Help
Entry
101953870         CDS       T04662                                 

Gene name
VPS41
Definition
(RefSeq) VPS41, HOPS complex subunit
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpic04131]
    101953870 (VPS41)
Membrane trafficking [BR:cpic04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    101953870 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_1 Vps39_2 ANAPC4_WD40 zf-RING_5 PHD zf-RING_11 zf-RING_2 zf-rbx1
Motif
Other DBs
NCBI-GeneID: 101953870
NCBI-ProteinID: XP_005287382
Position
Un
AA seq 869 aa AA seqDB search
MAEAEEKEIRSNEESTDDSEHFVSVLPTEVQHLVKEDESEEEPKLKYERLSNGVTEILQK
DAASCMTVHEKFLALGTHYGKVYLLDVQGNITQKVDVSPVKINQISLDESGEHMGICSED
GKVQVFGLYSGEEFHETFDCPIKIVAVHPQFVRSHCKQFVTGGKKLLLYEKTWMNRWKPS
VLHEGEGNIRNVKWRGHLIAWANNMGVKILDMISKQRITNVPRDDISLRPDMYPCSLCWK
DNLTLIIGWGTSVKICSVKERHASEMRDLPSRYVEIIFQFDTEFYISGLAPLCDQLVVLS
YVKEVSEKTEMECCARPRLDIIQPLPESCEEISSDALTVRGFQENECRDYHLEHSEGESL
FYIISPRDIVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKTIKKHRILDIGLAYINHL
VEKGEYDLAARKCQKILGKNTELWEFEVYKFKEIGQLKAISRYLPRRDPILKPLIYEMVL
HEFLESDYEGFAMLIKEWPGDLYNNAIIVQVVVDHLKKDPQNRTLLRTLAELYTYDQRYG
KALEIYLTLRHKDVFQLIHKHNLFSSIRDKIVLLMDFDSEKAVDMLLDNEDKISIDRVVE
ELENRPELQHVYLHKLFKRDHHKGQKYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALE
ICQQRNFVEETVYLLSRMGNSRSALKMIMEELYDVDKAIEFAKEQDDGELWEDLILYSID
KPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILV
ADSLSLLKKMHRTQMKGVRVDEENICESCLSPILPSDASKSFSVTVFHCRHMFHKECLPV
PSTMSPLQFCNICSAKHRGPGSAILEMKK
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcagaggagaaggaaatcaggtctaacgaagaatctacggatgattctgag
cattttgtgtctgtccttcctaccgaggtgcagcatcttgtaaaggaagatgagagtgaa
gaagaacccaagctgaagtatgaaaggctttctaatggagtgactgaaattctccaaaag
gatgcagccagttgcatgaccgtgcatgaaaagtttttggcactcggcacacattatggc
aaggtttatttacttgatgtccagggaaacatcacccaaaaggttgacgttagcccagtg
aagataaatcagatcagcctggatgaaagtggagaacatatgggcatatgctcggaagat
ggcaaggtgcaggtatttggattgtattcaggagaagaatttcatgaaacatttgactgt
cctattaaaattgttgctgtccaccctcagtttgtaagatcccactgcaaacagtttgta
acgggaggaaaaaagttgctgttatatgagaagacttggatgaacagatggaagccttct
gttttacacgaaggagaaggaaacataagaaatgtaaaatggagaggacacttaattgct
tgggccaataatatgggtgtgaagatacttgacatgatctccaagcaaagaattaccaat
gtgcctcgtgatgatataagccttcgcccagatatgtatccctgcagcctttgctggaaa
gataatttaacactgattattggctggggaacttcagtaaagatatgttcggtaaaggaa
cggcatgccagtgaaatgcgagacctgcccagccgctatgtagaaataattttccagttc
gatactgaattctacatcagtggacttgcacctctctgcgaccagcttgttgtactttca
tacgtaaaggaggtttctgagaaaacggaaatggaatgttgtgcaagacctagactggat
attattcaacccctacctgagtcttgtgaggagatctcctctgatgctctgactgttaga
ggattccaagaaaacgaatgtagagattatcatttagagcattcagagggtgaatcgctg
ttttacattattagtccaagagatattgttgtggctaaagagcgggaccaagatgaccac
attgactggcttcttgaaaagaagaaatatgaagaggctttgatggcagctgagatcagt
cagaagaccataaaaaaacacaggattttggacataggcttagcctatataaatcatcta
gtggagaaaggagagtatgacttggctgccagaaaatgtcagaaaatacttggaaaaaac
acagaactctgggaatttgaagtttataagtttaaagaaataggacaacttaaggcaatt
agccgttatttgccaagacgggatccaattctgaagcctctcatctatgaaatggtcctg
catgagtttttggagagtgactatgagggtttcgcaatgctgataaaagagtggcccgga
gatctctataacaatgcgatcatagttcaagtagtagtggatcacctgaagaaagaccca
cagaataggaccttgctgagaactcttgcggaattatacacctatgaccaacgctatggc
aaagcccttgaaatttacctaacactgagacacaaagatgttttccagttgatccataaa
cataatcttttcagttctatcagagacaaaattgttttactcatggattttgattcagag
aaagcagtggacatgctattggataatgaagataaaatttcaatcgacagagttgtagaa
gaattagaaaacagacctgaattacaacatgtgtatttgcataagcttttcaagagagac
catcataaaggacagaagtaccatgagaaacagatcagtctctacgctgaatacgatcgt
ccaaacctgctgccgtttctcagagacagcacacattgtccgctagagaaggctcttgag
atctgccaacagaggaactttgtagaagagaccgtctatcttctgagcagaatggggaat
agccgtagtgcactgaagatgataatggaagaattgtatgatgtagataaggctattgaa
tttgccaaggaacaagatgatggagaactatgggaagacctcattttatattctatcgac
aaaccaccttttattactggcttgttaaacaacattggtacccacgttgaccctattctt
ctgattcaccgcattaaggaaggcatggagattcctaatctgagagattcactggtgaaa
attctccaggattacaatttgcagattttgctacgtgagggatgcaagaagatacttgtt
gcagactcactgtcactattgaagaaaatgcaccgaactcaaatgaaaggcgtccgcgtg
gatgaagagaatatctgtgaatcgtgtctttcccctatacttccttcagatgcatccaaa
tccttcagtgtgacagtgttccattgcaggcatatgtttcacaaagagtgcctccctgta
cctagcacaatgtccccattgcagttctgcaacatctgcagtgctaagcacagaggacca
ggcagtgcgatcttggagatgaaaaaatag

DBGET integrated database retrieval system