KEGG   Chrysemys picta (western painted turtle): 101954097Help
Entry
101954097         CDS       T04662                                 

Gene name
SLC29A1
Definition
(RefSeq) solute carrier family 29 member 1 (Augustine blood group)
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpic02000]
    101954097 (SLC29A1)
Transporters [BR:cpic02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   101954097 (SLC29A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 101954097
NCBI-ProteinID: XP_005296375
Position
3
AA seq 456 aa AA seqDB search
MMTSSGPSDRYKAVWLIFFTLGLGTLLPWNFFMTATRYFTNRLGDPQNTSSLERLHGLNR
TYEGRELPPTYLQARFNNFMTLCAMLPLLIFTCLNSFLHQRIPQKVRILGSLVAILLVFM
MTAALVKVPLEPLSFFIVTMVKIILINSFGAILQGSLFGLAGLLPVSYTAPIMSGQGMAG
TFAALAMICAIASGSLLADSAFGYFITACVVVLLAIGSYILLPRLDFFRFHSMKDKTEYR
VHERHAELETKIDLIKKDEPNGVEQSYPSNTAPQVPGQKPSVFSIFKKIWIMALSVCLVF
TVTIGVFPAVTAEVKSTIAGSSKWEMYFIPVSCFLMFNVFDWLGRSLTAVCLWPGKDSRL
LPFMVAARIVFIPLFMLCNVQPRSHMPVFFHHDAWYISFIILFSVSNGYLASLCMCFGPK
KVLNHEAETAGAIMAFFLSLGLALGAMFSFLFRVVI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgagcagtggtccctcagacaggtataaagccgtctggctgatcttcttcacc
ctcggcctggggacgctgctgccatggaattttttcatgacagccaccaggtatttcacc
aaccgcctcggggatccccagaacacttcctccttggaacgcctccatgggctgaaccgc
acgtatgagggccgggagcttccccccacctacctgcaggccaggttcaacaacttcatg
acgctctgcgccatgctacccctgctcatcttcacctgcctcaactccttcctccaccag
aggatcccccagaaagtccgtattctgggcagcctggttgccatccttctggtcttcatg
atgacagctgccttggtaaaggtccccctggagccgctctccttcttcattgtcaccatg
gtcaagatcatcctcatcaattcctttggtgccatcctccaaggcagcctctttggattg
gctgggctgctgcctgtcagctacacagcccccatcatgagcggacagggcatggcaggg
accttcgcagctctggccatgatctgcgctatcgccagtggctcattgctggcagacagc
gcctttggctacttcatcacagcctgcgtggtggtcctgctggccatcggctcctacatc
ctgctgccccgcctggatttcttccgtttccactcaatgaaggacaagaccgagtatcgg
gtccacgagaggcatgctgagctggagaccaagatcgacctgatcaagaaagatgagccc
aatggggtggaacagagttacccgagcaacacggccccccaagttcccggccagaagccc
tccgtcttcagcatctttaagaagatctggatcatggctctgtccgtctgcttggtcttc
actgtcaccattggggtcttcccggccgtcaccgccgaggtgaagtccacgatcgccggg
agcagcaagtgggagatgtacttcatccctgtctcctgtttcctgatgtttaatgtcttc
gactggctgggacgaagcctcacggccgtctgcttgtggcccgggaaagacagccggctc
ctgcccttcatggtggctgcccgcatagtcttcatccccctcttcatgctgtgcaacgtg
cagccccgcagccacatgcccgttttcttccaccatgacgcctggtacatcagcttcatc
atcctcttctccgtctccaatggctacctggccagcctctgcatgtgctttgggcccaag
aaggtgctcaaccacgaagctgagacggccggagccatcatggcatttttcctctcgctg
ggcctggcgctgggagccatgttctccttcctcttccgggtggtgatctag

DBGET integrated database retrieval system