KEGG   Chrysemys picta (western painted turtle): 101954128Help
Entry
101954128         CDS       T04662                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00260  Glycine, serine and threonine metabolism
cpic01100  Metabolic pathways
cpic01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101954128
Enzymes [BR:cpic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     101954128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101954128
NCBI-ProteinID: XP_005283100
Position
Un
AA seq 354 aa AA seqDB search
MRQAMAQAEVGDDDYGEDPTVNELQRLAAQLLGMEEALFVPTSTMANLIAVMCHCQRRGA
QLLVGREAHLHVFEQGGVAQVAGVHSQVLQDLPEGTLDLDKLESTVRAGYGSRYHPRSVL
VCLENTHSSAGGRVLPLAYLREVRLLADRYGLHIHMDGARLMNAAVAQGVAPAQITQHCD
SVSLCFSKGLGAPAGALVAGCREFVAEAWRMRKLLGGGMRQAGVLAAAARVGLERMEETL
QRDHGNARSFAQGVWELGSPICSVDPSTVETNMVLVKVAVPWLSPEKLCERMQAVSEEEV
AETGRAVSVRLFPWAARSLRAVWHCDVSAQDTQLAANKLKFVAEQCWRERGAAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagacaggccatggcccaggccgaggtgggggatgatgactatggggaggacccgaca
gtcaatgagctccagcgcttggccgcccagctcctaggaatggaggaagctttgtttgtg
ccaacgtcgaccatggcaaacctcattgctgtgatgtgccactgccagcgcaggggggct
cagctgctcgtcgggagggaggcccatctgcacgtcttcgaacagggcggggttgctcag
gtagctggggtccattcccaggtgctacaggatctgccagagggcaccttggacctcgac
aagctggagtcgacagtccgtgcgggttatggcagccggtaccaccctcgctcagtgctc
gtctgcctggagaacacccacagctctgcagggggccgggtgctcccccttgcctacctc
agggaggtgcgcctgcttgctgaccgctacgggctgcacatccacatggacggggcgcgg
ctgatgaacgcagccgtggcccaaggcgtggccccagctcagatcacccagcactgcgac
tccgtctccctctgcttctccaaggggctgggtgccccggccggggcgctggttgctggg
tgcagagagttcgtggcagaggcttggcgcatgcggaagctgcttggtggagggatgcgc
caggcaggagtgctggcggccgctgcccgcgtagggctggagcgcatggaggagacactg
cagagagaccacggcaacgcccgcagcttcgcccaaggcgtctgggagcttggctcgccc
atctgctccgtcgacccctcgaccgtggagaccaacatggtgctggtgaaggtggctgtg
ccctggctgtcccctgagaagctgtgtgagcgcatgcaggcggtgagcgaggaggaggtg
gctgagacggggcgtgctgtcagcgtgcggctgttcccgtgggccgcgcgctccctgcgg
gctgtctggcactgtgacgtctccgcacaggacacccagctggcagccaacaagctgaaa
tttgtggccgagcagtgctggcgggagcgaggtgctgcaccctag

DBGET integrated database retrieval system