KEGG   Chryseobacterium piperi: CJF12_01140Help
Entry
CJF12_01140       CDS       T05071                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
cpip  Chryseobacterium piperi
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CJF12_01140
Enzymes [BR:cpip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     CJF12_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_12 MTS PCMT Ubie_methyltran TehB Methyltransf_32 Methyltransf_33 Methyltransf_4 DREV Methyltransf_2 Rsm22
Motif
Other DBs
NCBI-ProteinID: ASW73031
UniProt: A0A086BIF0
Position
complement(230160..230927)
Genome map
AA seq 255 aa AA seqDB search
MPWNPDVYNQFKDIRFKPFYDLADLIKEETPMKAVDLGCGTGEQTAILTEKFPHAEFTGI
DSSPEMLEKSKTLENERLHFKMAPTEEMLNSNESWDLIFSNAALQWSDDHPTLFPKLITK
LKTNGQLAIQMPYQPENILNKILYSLAEEEPFKAQLNGWNRPSAVLTIDEYAQLLFENGI
EDLNLSQKVYPIIAADHETLYNFISGSALIPYLERLNQEQQNEFTTEFKKRIAKAFPKLP
AIYAFKRILMYGRKK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccttggaatcctgatgtttacaatcaatttaaagatatccgttttaaaccgttttat
gatcttgctgatctgatcaaagaggaaactcctatgaaagcagttgatttaggttgcgga
acaggagaacaaaccgctatccttacagagaaattccctcacgcagagtttactggtatt
gattcttcccctgaaatgttggaaaaatccaaaacactggaaaatgaacgcctccatttt
aaaatggcacccactgaagaaatgcttaacagtaatgaaagctgggatcttatctttagc
aatgcagctttacaatggtccgatgatcatcccactttatttccgaaactaattacaaaa
ctgaaaaccaacggccaactggcgatacaaatgccttatcagccggaaaacatcctcaat
aagatcttatattcacttgcagaagaagaaccattcaaagcccaactcaacggatggaac
cgtccctcagcagtgcttaccattgatgaatatgcacagcttttgtttgaaaatggcatt
gaagatctcaacctttcacaaaaggtatatccgattatcgcagcggaccatgagacttta
tataattttatttccggttctgcattgattccctatctggaaagactgaaccaggaacag
caaaacgaatttactacagaatttaaaaaacgtattgctaaggcattccctaagcttcct
gctatttatgcattcaagagaattttaatgtatggaagaaaaaaataa

DBGET integrated database retrieval system