KEGG   Chryseobacterium piperi: CJF12_03405Help
Entry
CJF12_03405       CDS       T05071                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00480  Glutathione metabolism
cpip00590  Arachidonic acid metabolism
cpip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CJF12_03405
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CJF12_03405
Enzymes [BR:cpip01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CJF12_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA RuvX
Motif
Other DBs
NCBI-ProteinID: ASW73430
UniProt: A0A086BCH7
Position
753486..754061
Genome map
AA seq 191 aa AA seqDB search
MKKIFLLLLSFVAFLQSCTNQKSEISKAKTNELMGKTIYDFKVESLDGKEINFADFKGKK
ILIVNTASECGFTPQYADLEKVYEEYKDKLVVVGFPANNFGGQEPGTNTEIGAFCQKNFG
VTFPLAAKVSVKGDDTAPIFKYLTERDLNGVKNTTILWNFTKFLVDENGKLIDSFVSTTK
PTDQAITKYLK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatttttttattgctgctatcttttgtagccttcttacagagttgtactaat
cagaaaagtgaaatttctaaagctaaaaccaacgaacttatgggaaaaacaatatatgat
ttcaaagttgaaagcctggatggcaaagaaatcaattttgctgattttaaaggaaagaaa
atccttattgtaaatactgcctcagaatgtggttttactccacaatatgctgatttggaa
aaggtatatgaagagtataaagataaattggtagttgttggctttcctgcgaataatttc
ggaggtcaggagccgggaaccaatactgagatcggagctttttgccagaaaaactttggg
gtaacatttccattggccgctaaagtttctgtaaagggagatgatactgctcccattttt
aagtacttgacagagagagacttaaatggtgttaaaaatacaaccatcctttggaatttt
accaaattcttagtagatgagaatggcaaactaatcgacagctttgtaagtactacaaaa
ccgacagatcaggcaattacgaagtatttgaaataa

DBGET integrated database retrieval system