KEGG   Chryseobacterium piperi: CJF12_03590Help
Entry
CJF12_03590       CDS       T05071                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00260  Glycine, serine and threonine metabolism
cpip01100  Metabolic pathways
cpip01110  Biosynthesis of secondary metabolites
cpip01120  Microbial metabolism in diverse environments
cpip01130  Biosynthesis of antibiotics
cpip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJF12_03590
Enzymes [BR:cpip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CJF12_03590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Toprim OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ASW73462
UniProt: A0A086AWN6
Position
799580..800608
Genome map
AA seq 342 aa AA seqDB search
MKFSFKNDYSEGCHPHILQSLLQHNLDQQAGYGEDEYSLLAKKLIKEKINNKDSEVYLVS
GGTQANLIVISSILKPYQCVVSASTGHILNNEAGAIEATGHKVLSIETADGKLRPSDIVP
VLEGHMNVPHQVMPKLVYISNSTELGTVYNHQELKELSDFCKRNQLYLFMDGARLGHGLT
AEISDLTLEKVAQLTDIFYLGGTKNGALIGEAIVLNNQVLQEDFAYNIKQKGALLAKGRL
LGIQFAELMKNDLYFDLARHANQQAMKIKNALKEKGFESLSDTYTNQIFPILPHDLIQVL
SGKFDFYVWKKIDENFSAIRLITSWNTPDEAVNDFIEIIKNF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctcattcaaaaacgattattcagagggatgccatcctcatattttacaatct
cttttacagcataatcttgatcagcaggccggctatggtgaagatgaatattctttactg
gcaaaaaaactgatcaaagaaaaaattaataataaagactctgaagtctatctggtgtcg
gggggaacacaagctaatctgatcgttatttcttcgattttaaaaccttaccagtgtgtc
gtttcagcttctacaggacatattttgaataatgaagccggagcgatcgaagcaaccggt
cataaggttttaagtattgaaactgcagatgggaaattaagaccatctgatattgttcct
gttctggaaggacatatgaatgttccacatcaggtaatgccaaaactggtctatatttcc
aattctacggaactgggaactgtttacaatcatcaggagctgaaagaactttccgacttt
tgtaaacgaaatcaactgtatctcttcatggacggtgcaagattggggcatggattaacg
gctgaaattagtgatcttacactggaaaaggtagctcagctgactgacattttttatttg
ggtggaactaaaaacggagctttaattggagaggctatagtgcttaataatcaagtactt
caagaagattttgcctataatattaagcaaaaaggagcactgctggcaaagggtagatta
ttgggaattcaatttgcagagctgatgaaaaatgacttgtattttgatctggcccgtcac
gctaatcagcaggcaatgaagatcaaaaatgctttgaaagaaaagggattcgaatcgttg
tcagatacctataccaatcagattttccctattttacctcatgatttaattcaggtgtta
tcggggaagtttgatttttatgtgtggaaaaaaatcgatgaaaatttttctgctatccgt
cttattacttcctggaatactcctgatgaagcagtgaatgattttattgaaattattaaa
aatttctaa

DBGET integrated database retrieval system