KEGG   Chryseobacterium piperi: CJF12_04195Help
Entry
CJF12_04195       CDS       T05071                                 

Gene name
bioA
Definition
(GenBank) adenosylmethionine--8-amino-7-oxononanoate transaminase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00780  Biotin metabolism
cpip01100  Metabolic pathways
Module
cpip_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CJF12_04195 (bioA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpip01007]
    CJF12_04195 (bioA)
Enzymes [BR:cpip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     CJF12_04195 (bioA)
Amino acid related enzymes [BR:cpip01007]
 Aminotransferase (transaminase)
  Class III
   CJF12_04195 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASW73569
UniProt: A0A086ALE3
Position
complement(943641..944924)
Genome map
AA seq 427 aa AA seqDB search
MNNELKRRDRAVNWHPYTQMKTADDAIPIIRGKGTYLYDNEGKKYLDAVSSWWVTLHGHA
HPYIAQKVFNQLNTLEQVIFAGFTHEPAIQLSENLLNLLPENQGKVFYSDNGSTAVEVAL
KMSIQYAYNQGKAKNKILAFKDAYHGDTFGAMSVSGRSAWTQPFGGMLFEVIFIDTPHSG
NLDDLKTQISNVADETACFIYEPLVQGAAGMLMHSAEDLSELMKFCRTKEIILIQDEVFT
GFGRTGKLFAAHHLSEQPDIMCFSKGLTGGTMPMGITTCSEEIFNAFLSDDKYKTLFHGH
SFTANPLACTAALASMELLLQENTQFAIQRICKQHSDFTKILNEHDLVENVRQTGTILAW
DLKTDQGTSYFNETGKKIYDEFLSRGIIMRPLGNTMYLVPPYCITYEELDFIYKNIIKVL
HLFLQQK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgaattaaaaaggagagaccgggcagtgaactggcatccctatacacagatg
aagacggcagatgatgccattcccattatcaggggaaaaggaacctatctgtatgataat
gaaggaaaaaaatatcttgatgcggtttcttcatggtgggttactttacacggacatgct
catccatatattgcacaaaaggtatttaaccaactgaatacactggaacaggtcatcttt
gccgggtttacccatgagcctgccatacagctttctgaaaacctgcttaaccttcttcct
gaaaatcaaggaaaggttttttattcagataatggatctactgccgtagaagttgcttta
aaaatgagtatacaatatgcttataatcagggcaaagcaaaaaataagatactagcgttt
aaggatgcttatcatggggatactttcggtgccatgtctgtaagcggaagaagcgcatgg
actcaaccttttggaggaatgttgtttgaagtgatcttcattgatacccctcattccggt
aatctcgatgatctgaaaacacagatcagtaacgtagctgatgaaacagcctgctttata
tatgaacctttggtacagggagcagcaggaatgctgatgcattctgccgaagatctcagc
gaactgatgaaattctgccgaaccaaagaaattatcctgattcaggatgaggttttcaca
ggatttggaaggacaggaaaactttttgcagctcatcacctttctgaacaaccggatatc
atgtgcttttcaaaaggattaacaggcggaactatgccaatgggaattactacctgttca
gaagaaattttcaatgcttttttatcggatgataaatataaaaccttatttcatggccat
tcatttactgccaatccgctggcttgtactgctgcactggcaagtatggagcttttatta
caggaaaatacacagtttgccatccagaggatttgtaagcaacattctgatttcaccaaa
atcctaaatgagcatgatcttgttgaaaatgtaagacaaacaggaactattttggcctgg
gacttaaagaccgatcagggaacctcctattttaatgaaactggtaaaaagatctacgat
gagtttttatcacggggaattattatgcgtcctctgggaaatacaatgtatctggtacct
ccatactgtattacttatgaagaacttgactttatttataaaaatatcataaaagtactt
catctatttcttcaacagaaatag

DBGET integrated database retrieval system