KEGG   Chryseobacterium piperi: CJF12_06740Help
Entry
CJF12_06740       CDS       T05071                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00220  Arginine biosynthesis
cpip00300  Lysine biosynthesis
cpip01100  Metabolic pathways
cpip01110  Biosynthesis of secondary metabolites
cpip01120  Microbial metabolism in diverse environments
cpip01130  Biosynthesis of antibiotics
cpip01210  2-Oxocarboxylic acid metabolism
cpip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CJF12_06740
   00220 Arginine biosynthesis
    CJF12_06740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpip01007]
    CJF12_06740
Enzymes [BR:cpip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     CJF12_06740
    2.6.1.17  succinyldiaminopimelate transaminase
     CJF12_06740
Amino acid related enzymes [BR:cpip01007]
 Aminotransferase (transaminase)
  Class III
   CJF12_06740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASW74020
UniProt: A0A086BJL4
Position
complement(1518640..1519791)
Genome map
AA seq 383 aa AA seqDB search
MNLFNVYPLFNINPVKAQGSFLWDDKGEKYLDFYGGHAVISIGHNHPHYQSKLKDQLDKI
SFYSNSVQNELQTELAEKLGELSGYQDYNLFLCNSGAEANENALKLASFHNGKSKVIYFS
GAFHGRTSAAVSVTDNPKIVAPVNYSERFIKSEWNNIEQLEEIFKTQGNDISSVIIEGIQ
GVGGIMIPTAEFLSKIKELCEQHNAVLILDEVQSGYGRSGYFFAHQEFGVQPDIITIAKG
MGNGFPIGGVLIHPKFKASNGLLGTTFGGNHLACAAAIAVLDVMKDENLMANAENMGQYI
ENEIKDFPHIKSIRRKGLMIGIELDRDCSEVRKSLLYDHHIFTGNSNDKSVLRILPALNI
RKEETNLFINALKGVLQESCEIV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacttattcaacgtatatccattattcaatatcaatcctgtaaaagctcagggatca
tttctctgggatgataagggagaaaagtatcttgatttttacggaggacatgccgtaatt
tctattggtcataatcatccgcattatcagtcgaaactgaaagatcagttagataaaatt
tctttttattccaattcagtacagaatgaattgcaaactgaactggctgagaagcttggg
gaattatcaggatatcaagattataatctctttctgtgtaattccggtgcagaagccaat
gaaaatgctttaaaactagcttcttttcataatgggaaaagcaaagtgatttatttttcg
ggagcatttcatggacgaacttctgcggctgtttcagtaacggataatcctaaaattgta
gcaccggttaattattccgaacgcttcattaaatcggaatggaataatatcgaacagctg
gaagaaatatttaaaacccagggaaatgatatttcttctgttattattgaaggaatccag
ggagtaggaggaattatgattccgacagcagagtttttatctaaaattaaagaattgtgt
gaacagcataatgctgttttgattttagacgaagtacaatctggatatggaagatcagga
tacttctttgctcatcaggaatttggagttcaaccggatatcatcactatcgcaaaagga
atgggaaatggattccctattggaggtgttttgattcatccgaaatttaaagcaagtaat
ggtttattaggaactacttttgggggaaatcatttggcttgtgcagctgcaattgctgtc
ctggatgttatgaaggatgagaacctgatggccaatgctgaaaatatgggacaatatatt
gaaaatgaaattaaggactttccacacattaaatctatccgaaggaaaggactgatgatt
ggaattgagctggatagggattgctcggaagtgaggaaaagtctgctttacgatcatcat
atttttactggaaattctaatgataagtctgtactgaggattcttcctgcacttaatatc
aggaaagaggaaacaaatcttttcatcaatgctttgaaaggtgttttgcaggagagttgt
gaaattgtttaa

DBGET integrated database retrieval system