KEGG   Chryseobacterium piperi: CJF12_13300Help
Entry
CJF12_13300       CDS       T05071                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cpip  Chryseobacterium piperi
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpip03016]
    CJF12_13300
Enzymes [BR:cpip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CJF12_13300
Transfer RNA biogenesis [BR:cpip03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CJF12_13300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ASW75162
UniProt: A0A086BN55
Position
complement(3030310..3031005)
Genome map
AA seq 231 aa AA seqDB search
MLEILYRDEHLIAINKPSGLLVHKSFYSGEADTYAIQELRKQIGQYVFPVHRLDRKTSGV
LLFTLDKETLKIMSEEFATRQVEKKYIAILRGWAKEEETIDYDLINENEVRQNAITYYHR
LQTSEIELPFLKHQTSRYCLVEAIPETGRFHQLRKHFKHILHPILGCRKHGCNKQNKLWL
QTFGINKMTLHAHQLVFNHPISNQRITVNATVDSEFKRVGDILNFDLSSYS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattctttaccgcgacgaacatcttattgctattaataaaccaagcggatta
ttggtacataagtctttttattctggggaagcagatacttatgctatccaggaattgaga
aagcagattgggcaatatgtttttcccgtacatcgccttgaccgaaaaacttcgggtgtt
ttgctgttcactttagataaagaaacgttgaaaatcatgagtgaggaatttgctacacga
caggttgaaaagaaatacatcgcaattcttcgtggttgggcaaaagaagaagaaactatt
gattatgatttaattaatgaaaacgaagtcaggcaaaacgcgattacgtattatcatcgt
ttacagacttcagaaatagaattaccttttttaaaacatcaaacttcaagatattgttta
gttgaagccattcctgaaacaggaaggtttcatcagttgagaaaacattttaagcacatt
ttacaccctattctaggttgtcgtaagcacggatgcaacaaacaaaataagttgtggctt
caaacatttggcatcaacaaaatgacgcttcacgcccatcaattggtttttaatcaccct
atttctaaccaaagaattacggtaaatgcaactgtcgatagtgaatttaaaagagtagga
gatattttaaatttcgatttgagttcatattcttaa

DBGET integrated database retrieval system