KEGG   Chryseobacterium piperi: CJF12_16525Help
Entry
CJF12_16525       CDS       T05071                                 

Gene name
rocD
Definition
(GenBank) ornithine--oxo-acid transaminase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00330  Arginine and proline metabolism
cpip01100  Metabolic pathways
cpip01110  Biosynthesis of secondary metabolites
cpip01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CJF12_16525 (rocD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpip01007]
    CJF12_16525 (rocD)
Enzymes [BR:cpip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     CJF12_16525 (rocD)
Amino acid related enzymes [BR:cpip01007]
 Aminotransferase (transaminase)
  Class III
   CJF12_16525 (rocD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASW75724
UniProt: A0A086BLR2
Position
complement(3755057..3756307)
Genome map
AA seq 416 aa AA seqDB search
MSTVETAKNSQYFIDLEDKHGAHNYHPLPVVLDRGEGIFVWDVEGKKYYDFLSAYSAVNQ
GHSHPKIVEALVNQAKKLALTSRAFYNSNLGEYEKKIKNLFGFDKVLPMNSGAEAVETAV
KLARKWSYEVKGIAENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYGPFTPGFIKIPYN
DIAALEKVLTNEAQDIAAFLVEPIQGEAGVYVPDEGFLKQASDLCKKHNVLFIADEVQTG
IARTGKLIACHHENVQPDILILGKALSGGMYPVSAVLANDSVMNVIKPGQHGSTFGGNPI
ACAVAVAALDVVADEKLSEKAEQLGKLFRSEIEKLIEKSDLITKVRGKGLLNAILINDTP
DSSTAWNLCLKLKENGLLAKPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILDFKK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagtagaaacagcaaaaaattcacagtattttattgacctagaagacaagcat
ggagcacataattaccaccctcttccggtagttttagaccgtggtgaaggcatttttgtt
tgggatgtggaaggtaaaaaatattatgattttctttcagcttattctgctgtaaaccaa
gggcattctcatcctaaaatcgttgaggctttagttaatcaagctaaaaaattagcttta
acttcaagagcgttttataattccaatctaggcgaatatgaaaagaaaatcaaaaatctt
ttcggttttgacaaggtattacctatgaactcgggagctgaagccgtagaaacggctgta
aagctagccagaaaatggagttatgaagtaaaaggaattgctgagaatgcagcaaagatt
attgtttgtgaaaataatttccacggaagaacaacaacgattgtttctttctcaaacgat
ccggatgctaaccagaattatggaccttttacacctgggtttattaaaattccttacaat
gacattgctgcattagaaaaagttttaactaatgaagctcaggatattgctgcatttttg
gttgaacctattcagggcgaagccggagtttatgttcctgacgaaggtttcttgaagcaa
gcatctgatttatgtaaaaagcataacgttcttttcattgcagacgaagtacaaacaggt
attgcaagaacaggtaaattaattgcctgccatcacgaaaatgtacaaccggatatctta
attttaggaaaagcactttcaggagggatgtatcctgtttcagctgtattggcaaatgat
tctgtcatgaatgtgattaaacccggacagcatggttctacatttggaggaaatccaata
gcatgtgctgtagctgtagccgctctagatgttgtagctgatgaaaaattatctgaaaaa
gcagaacaactagggaagcttttcagaagtgaaattgaaaaactgatcgagaaatcagat
cttattaccaaagtaagaggaaagggtttactaaatgccattttaattaacgatacaccc
gatagttctactgcctggaatctttgtttaaaattaaaagaaaacggattattggcaaag
cctactcacggaaacattataagacttgctccaccattggttattacagaagagcaattg
cttgattgtgtaaaaattatagaaaaaactattttagatttcaaaaaataa

DBGET integrated database retrieval system