KEGG   Chryseobacterium piperi: CJF12_19700Help
Entry
CJF12_19700       CDS       T05071                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cpip  Chryseobacterium piperi
Pathway
cpip00860  Porphyrin and chlorophyll metabolism
cpip01100  Metabolic pathways
cpip01110  Biosynthesis of secondary metabolites
cpip01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CJF12_19700 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpip01007]
    CJF12_19700 (hemL)
Enzymes [BR:cpip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CJF12_19700 (hemL)
Amino acid related enzymes [BR:cpip01007]
 Aminotransferase (transaminase)
  Class III
   CJF12_19700 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASW76278
UniProt: A0A086B2Q1
Position
4450349..4451632
Genome map
AA seq 427 aa AA seqDB search
MRYQRSSALFDEAYQYIPGGVNSPVRAFKSVGGVPVFMKSAKGAYLTDEDNNTYIDYINS
WGPAILGHTHPEVLEELKLQAEKGFSFGAPTELETEIAKFIVENVPNIDQIRMVSSGTEA
CMSAIRLARGYTGRDKIVKFEGCYHGHSDSFLIKAGSGAATFGNPNSPGVTQGTAKDTLL
ARYNDFEQVEDLFRHNQGEIAAVIIEPVAGNMGCVLPENNFLQKLRKICDENGALLIFDE
VMTGFRLAFGGAQELFNVKADLVTYGKVIGGGLPVGAFAGRNEIMDYLAPKGGVYQAGTL
SGNPLAMRAGLKTLQLIKNDPAFFDNINKTTETLDFEIGKILNEKGIAHKINRKGSMMSV
FFHINRVSNFDEAQEANHALFNNFFHQMLTNGIYLPPSGYETYFISNAIKDKEIDMTLEA
VRKFEYS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagataccaaagaagttcagctttatttgatgaagcttatcagtacattccgggtggt
gttaattcacctgttcgggcgtttaaatcagtagggggagttcctgtattcatgaaatca
gcaaaaggggcttatctgacagatgaagataacaatacctatattgattatatcaattca
tgggggccggctattcttggacatacacatcctgaggttttagaagaattaaagttgcag
gcagagaaaggattttctttcggagcacctacggagctggaaactgaaatcgcaaaattt
atcgtagaaaatgtacccaatattgatcagatcagaatggtttcttcaggtacggaagct
tgtatgagcgccatacgactagcaagaggatataccggcagagataagattgtaaaattt
gaaggatgttatcatggacattcagattcttttttgatcaaagcaggaagtggtgcagca
acttttggaaacccaaattcaccaggggttactcagggaactgcgaaagatactcttttg
gcgagatataatgattttgagcaggttgaagatttattccgtcataaccagggtgagatt
gcagcagtaattattgaaccagttgcaggaaatatggggtgtgttcttcctgaaaataat
ttcttacaaaaactaagaaagatttgtgacgaaaatggggctttactgatctttgatgag
gtgatgacaggattcagattagcttttggaggtgctcaggaactttttaatgtaaaagca
gacttggttacttatggaaaagtaatcggaggaggtttgccggtaggagctttcgcagga
agaaatgaaattatggattatttggctcctaaaggaggcgtatatcaggctggaacatta
agtggaaatccgctagcaatgagagcgggattaaaaacccttcagctgattaaaaatgat
ccggccttctttgataatattaacaaaacaactgagactttggatttcgaaattggaaaa
attctgaatgaaaaaggaattgcccataaaatcaacagaaagggttctatgatgtcagtt
ttctttcatatcaacagggtttctaactttgatgaggcacaggaagcgaatcatgcttta
tttaataatttctttcatcagatgttgacgaatggaatctaccttccaccaagtgggtat
gaaacttattttatcagcaacgctattaaagataaggaaattgatatgacactagaagct
gtaagaaaatttgaatattcttaa

DBGET integrated database retrieval system