KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0001Help
Entry
Cp1002_0001       CDS       T01876                                 

Gene name
dnaA
Definition
(GenBank) Chromosomal replication initiation protein
  KO
K02313  chromosomal replication initiator protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cp1002_0001 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cpk03032]
    Cp1002_0001 (dnaA)
   03036 Chromosome and associated proteins [BR:cpk03036]
    Cp1002_0001 (dnaA)
DNA replication proteins [BR:cpk03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Cp1002_0001 (dnaA)
Chromosome and associated proteins [BR:cpk03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Cp1002_0001 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 AAA AFG1_ATPase RNA_helicase ATPase_2 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADL19909
Position
1..1812
Genome map
AA seq 603 aa AA seqDB search
MSEAPSTWNERWQEVTNELLSQSQDPESGISITRQQSAYLRLVKPVAFVEGIAVLSVPHA
RAKKEIETTLGPVITEVLSRRLGRQYSLAVSVHAPEENPEVSSATPDAVSDYQEQSAVSG
QYGATSANADFQNQQSTIYRKPQESQYPVTFGASSYGNEKYQENSQDQGISHHPYGFNEA
QRIASSASHAVPQSGSELLHDPVHTRRTDAALDQNYPGNTGGWRTEHIQEPMPTEQIPSG
TPRTREQPSFNPDRALALNPHYTFDSYVVSDSNKLPCSAAIAVAEKPARAYNPLFIWGDS
GLGKTHLMHAVGNYAQYLNPRLRIKYVSSEEFTNEYINSVRDDRQEAFKRKYRELDILMV
DDIQFLQGKEGTQEEFFHTFNALYQANKQIVLSSDRPPKQLTTLEDRLRTRFQAGLIADI
YPPDLETRIAILMKKAASESIVADREAIELIASRFNTSIRELEGAFIRVSAYASLMSPDK
GKHRVDLRIAEKALEDMMPEQANEEITATTILAATAEYFEMDVNALKGSGKTRAVAHARQ
LAMYLCRELTDLSLPKIGEQFGGKDHTTVMYADRKVRKEITEKKETYDEIQLLTQQIKSS
SRG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggaggctccatcgacatggaacgagcggtggcaagaagttactaatgagctgctg
tcacagtctcaggacccggaaagtggtatttccattacgcgacagcaaagcgcctacctg
cgtctggttaaaccagttgcttttgtagagggtattgccgttttaagcgttcctcacgcc
cgagcgaaaaaagagattgaaactacgctgggacctgttatcacagaggtattgtctcgt
agactaggtcgacaatacagtcttgcagtgagcgttcatgctccagaggaaaatccagaa
gtatcctcggccactccagatgctgtgtctgattaccaggaacaatctgcagtttctgga
caatacggagcaacttcagccaatgctgacttccagaatcaacaaagcacgatatatcgc
aagccacaggagtcgcagtatcctgtgacttttggtgcttcttcatacggaaatgagaag
taccaggaaaattcccaagaccagggcatttctcatcatccttatggttttaatgaggct
caacgcattgcttcatctgcctctcatgctgttccgcaaagtggttctgagctactgcac
gatcctgttcacacacgcaggacagatgctgccctagaccaaaattatccgggaaatacc
ggggggtggcgtactgagcatattcaggaacccatgcctactgagcagattccttccggc
acgccgcgtactcgtgagcagccatcgtttaacccggatcgtgcgctagcgctgaacccg
cactacacatttgattcttatgtggtcagcgattccaataagttaccctgctcagcagcg
attgctgtagcagaaaagccagcccgtgcttacaatcctctttttatttggggagactca
ggtttaggcaaaacccaccttatgcatgcagtgggtaactacgctcaatatttaaatccg
cgtcttcgcattaaatatgtttctagtgaggaattcactaatgaatatatcaattcagtg
cgagatgacaggcaggaagcattcaagcgtaaatatcgtgaactagatatcttgatggtc
gatgatattcagttcctccagggaaaagaaggaacccaggaagaattttttcatacgttt
aatgcgctgtatcaggcaaataaacagattgttttatcctcagacaggcctccgaaacag
ctgactaccttggaagatcggctacgtacgcgattccaggctggccttattgcagatatt
tacccgccagatttagaaactcgaattgcgattttgatgaagaaggcggcgtcggaaagc
attgttgctgatcgtgaggctatcgagctgatcgcgagccgttttaatacgtcgatccgc
gaattagaaggcgcttttattcgtgtttccgcgtatgcctcgctgatgtctccggataag
ggtaaacaccgtgttgatctgcggatagccgaaaaagcactcgaagatatgatgccggaa
caagcaaatgaagagattacggcaacgactatccttgcagctactgccgagtactttgag
atggatgttaatgcgctcaaaggcagtggtaagactcgtgcagtcgcgcacgcgcgtcag
ctagcgatgtacctttgccgcgagcttacagatttatcgctgcctaagatcggtgaacaa
tttggcggtaaagaccacaccacggtgatgtatgcggatcgaaaggttcgtaaagaaatc
accgagaagaaagaaacttatgatgagattcagctgctcacgcagcagattaagagttct
tctcgcggataa

DBGET integrated database retrieval system