KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0610Help
Entry
Cp1002_0610       CDS       T01876                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase echA6
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00071  Fatty acid degradation
cpk00280  Valine, leucine and isoleucine degradation
cpk00310  Lysine degradation
cpk00360  Phenylalanine metabolism
cpk00380  Tryptophan metabolism
cpk00410  beta-Alanine metabolism
cpk00627  Aminobenzoate degradation
cpk00640  Propanoate metabolism
cpk00650  Butanoate metabolism
cpk00903  Limonene and pinene degradation
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
cpk01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp1002_0610 (echA6)
   00650 Butanoate metabolism
    Cp1002_0610 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp1002_0610 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp1002_0610 (echA6)
   00310 Lysine degradation
    Cp1002_0610 (echA6)
   00360 Phenylalanine metabolism
    Cp1002_0610 (echA6)
   00380 Tryptophan metabolism
    Cp1002_0610 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp1002_0610 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp1002_0610 (echA6)
   00281 Geraniol degradation
    Cp1002_0610 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp1002_0610 (echA6)
   00627 Aminobenzoate degradation
    Cp1002_0610 (echA6)
   00930 Caprolactam degradation
    Cp1002_0610 (echA6)
Enzymes [BR:cpk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp1002_0610 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADL20503
Position
647195..647881
Genome map
AA seq 228 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALSSGFAAIRGDHAAAVAFAHEVAGLAPLSVR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggtgctgggatgcagcttgct
ttggcgtgtgatctccgtgttgttggagagtctgcatggtttaaagtccccgctgtttct
ttggggtttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcattgaccccggatgcggctctgtctagt
ggttttgctgcaatccggggcgaccatgctgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggtag

DBGET integrated database retrieval system