KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0723Help
Entry
Cp1002_0723       CDS       T01876                                 

Gene name
mca
Definition
(GenBank) Mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cp1002_0723 (mca)
Enzymes [BR:cpk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Cp1002_0723 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ADL20614
Position
766351..767241
Genome map
AA seq 296 aa AA seqDB search
MRRLRLLAIHAHPDDEASKGAATMAKYAAEGCDVLVLTCTGGERGDILNPAMDKPGILEN
MAQVRRQEMAESIRALGAQHRWLGYVDSGLPEGDPLPALPPGCFALADTEEATDKVVAVI
REFQPHVIITYDENGGYPHPDHLKVHEVSMRAWDLSGQASYKPELGAAWNPLKLYYTHGF
IRQRMQMFHNLLIQEGKESPYVDMLERWQVHRADIMARVTTQIRCDDYFEHRDAALRAHA
TQIDPAGAFFGTPVADQRRLWPTEEFELARTRVTTAIPEDDLFAGIDASYKKIERV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaggctaagactccttgccatacatgctcatcctgatgatgaggccagcaaaggt
gctgcgacaatggcaaagtacgccgctgaggggtgcgacgtactcgttttaacctgcact
ggtggtgagaggggagacatcctcaatccagctatggacaagccaggaatcttagaaaat
atggcgcaggtgcgcagacaggagatggctgagtcgattcgcgccttaggcgctcaacac
cgttggttgggctatgtggactcaggtttgccggagggagacccactgcctgcactgccg
ccaggctgctttgctcttgctgataccgaggaagcaacagataaggttgttgcggtgatt
cgagaattccagccgcacgtgatcattacttatgatgaaaatggcggttatcctcatcca
gatcatctcaaagtccatgaagtatctatgcgtgcatgggatctttcagggcaagcttcc
tataagccggagcttggggcggcgtggaatccgctcaagctgtattacacgcacggcttt
atccgtcaacgcatgcagatgtttcacaatttgctgattcaggaggggaaagaaagtccg
tatgtggatatgctcgagcgatggcaggttcatcgggcggacattatggcgcgagtaacc
actcaaattcgatgcgacgattattttgagcatcgcgatgcggccctgcgcgcgcatgct
acgcagatcgaccccgcaggggctttctttggcactccggtggcagatcagcggcgttta
tggcctacggaggaatttgagttggcaaggacacgagtgaccactgctatcccagaggat
gatcttttcgctggaatcgacgcgtcatataaaaagattgagcgtgtttaa

DBGET integrated database retrieval system