KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0785Help
Entry
Cp1002_0785       CDS       T01876                                 

Gene name
rrmA
Definition
(GenBank) Ribosomal RNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cpk03009]
    Cp1002_0785 (rrmA)
Enzymes [BR:cpk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Cp1002_0785 (rrmA)
Ribosome biogenesis [BR:cpk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Cp1002_0785 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_12 Methyltransf_31 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ADL20675
Position
828620..829486
Genome map
AA seq 288 aa AA seqDB search
MLSHVIDVLADPTDGTPLSLVDESTRLVSESGHSFDVARQGYVTLAGGAGLRYSGDDTSM
IRARETFLSSGHFAPFVEAVSSAVHTVLDEAGVADDAHPTICEIGAGTGYYLAHTLDDVD
NSVGLGIDVSVPAAKLLAKCHPRVGAVVADAWSRLPIQDASIDAITVVFAPRNASEFARV
LKPGGQVIVLTADTGHLGELREPLGIIDVEQGKVQRMIDQAAGHLTPVGEPEPVQFTMRL
DQDSIATQIGMSPSARHIHPDVLAERIATLPPVMEVTARAMITRFRKV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcacatgtcattgatgttcttgccgatcctactgatggaacaccactgagcttg
gtcgacgagtccacgcggctagtgtccgaatctgggcacagctttgatgttgcacgtcag
ggctatgtgactctcgctggaggcgccggtctgcgctattctggcgacgatacgtcgatg
atccgcgcccgtgaaaccttcctatccagcggtcactttgcaccattcgtagaagccgta
agctctgcggtgcatactgtcctcgacgaggccggtgttgcagacgacgcccaccctact
atctgcgagattggggccggaacgggctactatctagcgcacacgcttgacgacgttgat
aattccgtcgggctcggcatcgatgtatccgttcctgccgcgaaacttctggcaaaatgt
catccacgcgtaggcgccgtagtcgccgacgcctggtcccgtcttcctattcaagacgcc
tccatcgacgctattaccgtagtctttgcgccaagaaacgcctccgagtttgctcgtgtg
ctcaagcctggtggccaagttatcgtgctcaccgccgataccggacacctgggcgagctg
cgcgagccactcggcattatcgatgtggaacaaggaaaagtgcaaagaatgatcgatcag
gcggccgggcaccttacaccggtaggagagccagagccagttcaatttactatgcgctta
gaccaagactccattgctacccagatcgggatgagtccttcggctcgtcacatccatcca
gatgttttagctgagagaatcgcaacgctaccgccagtgatggaagtaactgcgcgagct
atgattactcgttttagaaaggtctaa

DBGET integrated database retrieval system