KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_0798Help
Entry
Cp1002_0798       CDS       T01876                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K01616  2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cp1002_0798 (odhA)
Enzymes [BR:cpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     Cp1002_0798 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh 2-oxoacid_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ADL20688
Position
complement(840670..844356)
Genome map
AA seq 1228 aa AA seqDB search
MSSASTFGQNDWLVDEMFQQFQKDPQSVDKEWRELSEEQGAPKKSGTPIENTSTQPTASA
YKPTEVAAKSENKPAQSAAKTPKPEKKVKKTQPSPLERAGEMPQAGEQTLKGIYKAIAKN
MDESLAVPTATSVRDMPVKLMFENRAIINEHLKRTKGGKVSFTHIIGYAVVKATMAHPDM
NNYYSVVDGKPTIHTPEHINMGLAIDVQQKNGTRALVVAAIKEAEKLSFSEFVAKYEDIV
ARSRVGKLTMDDYSGVTISLTNPGGIGTRHSVPRLTQGQGAIIGVGSMDYPAEFAGASQD
RLADLGVGKLVTITSTYDHRIIQGAESGEFLRTLSQLFIDDAFWDSIFKSVGIPYSPMRW
AQDLPNTGIDKNTRVMQLIEAYRSRGHLIADTNPLRWQQPGMPIPDHRDLDIATHGLTLW
DLDRTFNVGGFDGKECMTLREVLGKLRTAYTLKVGSEYTHILDRDERLWLQDRIETGMPK
FTQPEQKYILQQLNAAQAFEDFLQTKYVGQKRFSLEGAEALIPLMDSAIDTAAGQGLDEV
VIGMPHRGRLNVLVNVVGKPLATVFTEFEGHIEPKSAGGSGDVKYHLGAEGNHIQMFGDN
EIKVSLAANPSHLEAVDPVLEGIARAKQDILDKGKDGYTVMPIMLHGDAAFAGLGIVQET
LNLAQLRGYTVGGTVHIVVNNQIGFTTTPDSARSSHYATDLAKAYGCPVFHVNGDDPEAV
VWVGKLATEYRHEFGKDVFIDMISYRRRGHNEADDPSMTQPEMYKLIGARKTVREQYKEN
LLGRGELTAEDAEKVQRDFHDQMESIFNDVKESEKKPFKTQSGITSSQQVPHGLETNISR
EDLMEIAQAYATAPEGFEFHPRVAPVAQKRLSSAQNGGIDWGWAELIALGSLAAAGKFVR
LTGEDSRRGTFTQRHAVVSDPRNGTEFNGLNELAERKGNGGKFLVYNSALTEYAGMGFEY
GYSVGNGEAIVAWEAQFGDFANGAQTIIDEYVSSGEAKWGQKSSLILLLPHGYEGQGPDH
SSARIERYLQLSAEGTMTVAQPTTPANYFHLLRRHALGGLKRPLIVFSPKSMLRMKTATS
DVSDFTEVKKFQSVINDPRFAEGNLDPSKVKKIMLVSGKLYYDLAKRSEKDKREDVAIVR
IEMLHPIPFNRLRDAFNYYPNANEIRFCQDEPANQGPWPFLHEHLPELIPDMPPMKRVSR
RAQASTATGLNKVHAVEQSQLLDEAFAD
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgctagtactttcggccagaatgattggctggtagacgagatgttccagcag
ttccagaaggatccgcaatccgtagataaggaatggcgcgaactttctgaagagcagggt
gcacccaagaaatcgggcactcccatagagaacacgtccactcagcccacagcttcggca
tacaaacccaccgaagtagcagctaagagcgaaaataaacccgcccagtcggctgctaaa
actcctaagcccgagaaaaaagtgaagaaaactcaaccttcccccctggaacgcgcaggt
gagatgccccaagccggagaacaaacgctcaagggcatttacaaggccattgccaagaat
atggatgaatcgctcgcggttcccacggcaacctcggttcgcgatatgccggtcaagctc
atgtttgaaaaccgagcaatcattaatgagcacttaaagcgcaccaagggcggaaaagtc
tcgttcacacacatcatcggttatgcagtggtcaaggcgaccatggctcaccccgatatg
aacaactattactcagttgttgatggcaagcccacgatccatacacctgagcacatcaac
atgggtctagccatcgatgtgcagcagaaaaacggcactcgtgcgctcgtcgtagcggct
atcaaggaagcagaaaaactctccttctctgagtttgtagccaaatatgaggacatcgtc
gcacgctctcgcgtgggcaaactcaccatggatgattactccggtgtgacaatctcgctg
actaaccccggtggaatcggtacccgccattctgtgcctcgacttactcaaggacaaggc
gcgatcattggcgttgggtcaatggactatccagccgaattcgcaggagcttcccaagat
cgactcgctgatcttggcgtgggcaagctggtgactattacgtccacatacgatcaccgc
atcatccagggcgctgagtccggagaattcctccgcaccttgagtcagctattcatcgac
gatgcattctgggacagcatctttaagtccgtaggaatcccgtactcccctatgcgctgg
gcgcaggatcttcctaacacaggcatagacaagaacactcgcgtcatgcagctcattgag
gcatatcgttcccgcggtcacctcatcgcagacaccaacccattgcgttggcagcagccg
ggtatgccgataccagatcaccgtgacctagatatcgctactcacggactcacgttgtgg
gatcttgaccgaaccttcaacgttggcggcttcgacggcaaggaatgcatgaccctgcgt
gaggtgctcggtaagctacgcaccgcatacacgctcaaagttggttccgaatacacgcat
atcctcgatcgcgacgaacggctttggcttcaagatcgcattgagaccggcatgcctaaa
ttcacgcagccagagcagaaatacatcctgcagcagcttaatgcggcacaagcctttgag
gacttcctacaaaccaagtacgtcgggcaaaaacgcttctctcttgaaggcgcagaagcc
ctcatcccgctcatggattccgccatcgacacagctgccggacagggcctggatgaagtc
gttatcggtatgccacaccgcggacggctcaacgtcctagtcaacgtagttggaaaacca
ctcgcgactgtctttaccgaatttgaaggccacatcgagcctaagtctgccggtggctca
ggtgacgtcaaatatcacctcggcgcagagggcaatcatattcagatgttcggcgacaac
gagatcaaggtctcacttgctgctaacccctcgcatctcgaggccgtcgatccagttctg
gagggaatcgcccgcgctaagcaggacatcctagacaaaggcaaggacgggtacaccgtc
atgccaataatgctccacggtgatgcagcttttgctggacttggcattgttcaagaaacc
ctgaaccttgcccagctgcgtggttacacagtcggcggcactgttcacatcgttgtgaac
aaccaaatcggttttacaaccacaccggattctgcgcgttccagtcactatgccactgac
ttggccaaggcttatggctgcccggtcttccacgttaatggcgacgaccccgaggcagtc
gtatgggtaggcaagctagccaccgagtaccgtcacgaatttggaaaagacgtcttcatc
gatatgatctcctatcgtcgacgcgggcacaatgaagccgacgatccctcgatgacgcaa
cctgagatgtacaagcttatcggcgctcgtaagaccgtccgtgaacagtacaaggagaac
cttctcggccgaggtgagctcacggctgaagacgcagaaaaagttcagcgtgacttccat
gaccagatggaatccatcttcaacgacgtcaaagaatccgagaagaagcccttcaaaacg
caatcagggattacctcttctcagcaagtccctcatggtctggaaaccaacatctcgcgt
gaagaccttatggagattgcacaggcctatgccaccgcaccagaaggctttgaattccac
ccacgcgtggcaccagtggcccaaaagcgtctttcctcggcacaaaacggcggaatcgac
tggggttgggccgagctcatcgctctcggttctctcgctgcagccggaaagttcgtgcgg
ttgacgggtgaagactctcgacgcggaaccttcactcagcgccacgcggtcgtctccgat
ccgcgcaatggcacagagttcaacgggctgaatgagctcgccgagcgcaagggcaacggc
ggcaagttcctcgtctataactccgcccttaccgaatatgcaggtatgggttttgaatat
ggttactccgtaggaaacggggaagccatagtcgcatgggaagcccaattcggcgatttt
gctaacggcgcacaaaccatcatcgatgagtacgtttcttcaggtgaagcaaagtggggt
caaaaatcctcattgatcctcctactcccgcacggttacgagggccaggggccggatcac
tcttctgctcgcatcgagcgctacctacagctcagcgctgaaggaactatgacggtagct
cagccgaccaccccggctaattacttccacctcttgcgtcgccacgcactgggcgggctg
aaacgtccattgatcgtgtttagccccaagtccatgctgcgtatgaagactgccacctct
gatgtttccgacttcaccgaggtaaagaagttccagtcggtcatcaatgacccgcgtttt
gctgagggcaatcttgatccttccaaggtcaagaagatcatgttggtctcgggcaagctc
tactatgatctggccaagcgttcggaaaaggacaagcgcgaagacgtggcaatcgtccgc
atcgaaatgctgcatccaataccgttcaatcgtctccgcgacgcattcaactactatccg
aatgccaacgagattcgtttctgccaggatgaacctgccaaccagggaccgtggcctttc
cttcacgaacacctgccagagctcattcctgatatgccgccgatgaagcgcgtctctcgt
cgtgcccaggcatcaacggcaacggggctgaacaaagtccatgcagtggaacaaagccaa
cttctcgacgaagcattcgccgactag

DBGET integrated database retrieval system