KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1991Help
Entry
Cp1002_1991       CDS       T01876                                 

Gene name
ldh
Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00010  Glycolysis / Gluconeogenesis
cpk00270  Cysteine and methionine metabolism
cpk00620  Pyruvate metabolism
cpk00640  Propanoate metabolism
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp1002_1991 (ldh)
   00620 Pyruvate metabolism
    Cp1002_1991 (ldh)
   00640 Propanoate metabolism
    Cp1002_1991 (ldh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cp1002_1991 (ldh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpk04147]
    Cp1002_1991 (ldh)
Enzymes [BR:cpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     Cp1002_1991 (ldh)
Exosome [BR:cpk04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   Cp1002_1991 (ldh)
  Exosomal proteins of breast milk
   Cp1002_1991 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C NAD_binding_7 TrkA_N Sacchrp_dh_NADP ThiF SHMT F420_oxidored Shikimate_DH UDPG_MGDP_dh_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADL21847
Position
complement(2202043..2202993)
Genome map
AA seq 316 aa AA seqDB search
MKDIVGNKVVLIGAGDVGVAYAYALVNQGTVDHLAIIDIDEKKLEGNVMDLNHGVVWASS
RTKVTKGSYADCEDAAMVVICAGAAQKPGETRLQLVDKNMKIMKSIVDEVMANNFDGILL
VASNPVDILAYAAWKYSGLDWHRVIGSGTVLDSARFRYMLGERYEVAPSSIHAYIIGEHG
DTELPVLSSATVAGVSMRRQLEKNPGLDAELEKIFEETRDAAYAIIDAKGSTSYGIGMGL
ARITRAVIHNQEVALPVSALLQGEYGQENIYIGTPAVINRGGINRVVELELTDHEMERFT
HSANTLRDIQEQFFPV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcgtcggaaacaaagttgtgctcattggcgcaggtgatgttggggttgcg
tatgcgtatgcgctagttaatcaggggaccgtcgatcatctggccattattgatattgat
gagaaaaagcttgagggcaacgtcatggacctcaaccatggcgttgtgtgggcttcctcc
cggaccaaagtcacaaaaggcagctacgcggactgtgaagacgccgctatggttgtgatc
tgtgcaggggctgcgcaaaagcccggtgaaacccggctgcagctcgtggataagaacatg
aagatcatgaagtccatcgtggacgaggttatggccaataactttgatggcatccttctt
gtcgcctctaatcccgtggatatccttgcttatgccgcatggaaatattcaggactggat
tggcatcgggtgatcggttcaggaacggtcctcgactctgcccgcttccgctatatgctt
ggcgagcgctatgaagtcgctcctagctcgattcacgcttatattatcggcgagcatggc
gatacagagctcccggtcctttcctcggctaccgtcgcgggcgtatccatgcgccgacag
ctggagaaaaaccctggattggatgctgagctggagaagatattcgaggaaacccgcgat
gccgcttacgccattatcgacgccaaaggttctacctcttatggcattggcatggggctc
gcccgcatcacgcgcgcggtaatccataaccaagaggttgcactccctgtgtcggctctc
ttgcaaggagaatatgggcaggagaacatctatattggcaccccagcggtgattaaccgg
ggtggcattaaccgggtggttgaacttgaattgaccgatcatgagatggagcgcttcacg
cactccgccaataccttgcgagacatacaagaacagttctttcctgtataa

DBGET integrated database retrieval system