KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_1994Help
Entry
Cp1002_1994       CDS       T01876                                 

Definition
(GenBank) Flavin reductase
  KO
K19784  chromate reductase, NAD(P)H dehydrogenase (quinone)
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    Cp1002_1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: ADL21850
Position
2205175..2205759
Genome map
AA seq 194 aa AA seqDB search
MSNTSTKVSVLVGSLREGSFARKIALNAIEMLPSDWDANILEIRDLPLYDADYDDPAMTS
KPLPEAYTTFREELKASDAVLFVTAENNRTIPACLKNAIDVGSKPNSDVAWTGLPGGIIS
HSVGRMGGYSSHKNLRLALSYFAMPLTGQPEAFIGQSNTLIDDNGSISNEDTRAFIQRYL
DTFVELVKTNPRKR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacacatcaaccaaggtcagcgtcctcgtcggcagcctccgcgaaggttctttt
gcacgcaagatcgcacttaatgccatcgagatgctgcctagcgattgggacgccaacatt
ctagaaatccgcgatctgccactctatgatgcagattatgacgatcccgctatgacgtcc
aagccacttccagaggcctacacaactttccgggaagagctcaaagcgtcagacgccgtc
ctctttgtcacggcagaaaacaatcgcactatcccagcttgcctcaaaaacgctatcgac
gtcggctcaaagcccaacagcgatgtggcatggacaggactccccggaggaatcatcagc
cattcggtcggacgcatgggcggttacagctcgcacaagaacctccgtctcgcgctctct
tactttgcgatgccactcaccggccaaccagaggcattcattggccagtccaatacgctt
atcgacgataatggctccatctccaacgaggacacccgcgcattcatccagcgctacctt
gacacctttgtggaactagtaaagacgaatccgcgtaagcgctag

DBGET integrated database retrieval system