KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2000Help
Entry
Cp1002_2000       CDS       T01876                                 

Gene name
recB
Definition
(GenBank) RecB family nuclease
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_H_2
Motif
Other DBs
NCBI-ProteinID: ADL21856
Position
complement(2212828..2214390)
Genome map
AA seq 520 aa AA seqDB search
METDICLQPSDLVGCRYRLVQASRHPGVAPTHNSQLRYERRMQAKEEARAFFPTGPSIGD
PRNFLRIDIPPQGSTASEAVGTEAVETDPDAPWLATLEALAAQATIITNPVLLGEDDGRA
WRVRLDALVRRSEGTYMPILISNHRIARPHHQKTIKVMATSRLGLGTPYSAHFKLKHHAA
DSYTLALASRALDRLGVGSSRAGLIGQDRELVFLLNTDFFQQGLDVALAVPDPEHARRVK
ECASCRYWDFCEQELRASDDLSLFLSGDRGDPYRERGITTVDGLVDANLGAPSQLARAWR
DGVDILRKSPDVTFPRFDIEIDIDVEAYLDQGAYLWGAYDGEEYRPFVTWEGLGDESEAQ
AFAKMWTWLKQRRNAAIAAGKTIGVFCYSSHGENHWLKFSARRFHGRYEGVPSEAEVSQF
IASDEWQDVFVAVKKQLAGPKGLGLKVVAPAAGFHWDAEDVDGETSVHLYREATGDVVGA
DCEAARATLLSYNGDDCKATAAVRRWLSEGAPGVPALENG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccgatatatgcttgcaaccttctgatctggtgggctgccgctaccggctcgta
caagctagtcggcacccaggcgtagcgccaacgcacaattcccagctcagatatgaacgt
cgtatgcaggcaaaggaagaggctcgtgcgtttttccccaccgggccgagcataggagac
ccccggaatttcctgcgcatcgatatccccccgcaggggagcaccgcatcagaagcagtt
ggcacggaagctgttgaaacggacccagacgcgccgtggcttgccacattggaggcgctt
gccgcgcaggccaccattatcactaatcctgttctcctaggggaagacgatggccgagcg
tggcgagtacgtctggatgccctggtgcgtagatccgaggggacctacatgccgatcctt
atctctaaccaccggatagctaggccacaccatcagaaaacaattaaggtgatggctacc
tcgcgtctgggtctgggcactccctactctgctcatttcaagctcaaacaccatgctgca
gattcttataccttggcccttgcatcacgcgcgcttgatcgcctgggagtgggaagtagc
cgcgccgggttgatagggcaggatcgcgagctggttttccttcttaatacagatttcttt
cagcaaggtcttgatgttgctcttgcggttccggacccggagcatgctcgtcgcgttaaa
gaatgcgcaagctgtagatattgggatttctgcgaacaggagctgagggcctccgatgac
ctcagcctttttctttcgggtgatcgtggcgatccatatcgggagcgcggtatcactact
gtggatgggcttgtcgacgccaacctaggggcgccctcgcagctcgcgcgggcatggcgc
gacggggtagatatattgcgaaagtctcctgatgtaaccttcccgcgctttgatatagaa
attgatattgacgtggaagcctatttggaccaaggagcctatctttggggcgcgtacgac
ggcgaggagtaccgaccctttgtcacgtgggagggccttggtgacgagtctgaggcacag
gcgtttgcaaagatgtggacgtggctcaaacagcggcgtaacgcggcgattgcagctggc
aaaaccataggcgtgttctgctattcctctcacggggaaaaccactggcttaaattttcc
gctcgccgcttccatggacgctatgagggggttcctagtgaagccgaggtttctcaattc
attgcttctgatgaatggcaagatgtttttgtggctgtaaaaaagcaacttgctgggcca
aagggacttgggctcaaagtggttgcacccgcagcggggttccattgggatgctgaagac
gttgacggagagacaagcgtgcatctttatcgggaagccacaggagacgttgttggggct
gattgtgaggccgctcgggctactctcctgagctataacggcgatgactgtaaggccacg
gctgccgtgcgtcgttggttgtcggagggcgcgccgggcgttccggcgctggaaaatggc
taa

DBGET integrated database retrieval system