KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2002Help
Entry
Cp1002_2002       CDS       T01876                                 

Definition
(GenBank) LSR2-like protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lsr2 DUF3153
Motif
Other DBs
NCBI-ProteinID: ADL21858
Position
2215706..2216026
Genome map
AA seq 106 aa AA seqDB search
MARREITQFFDDIDNTPLDESEVRVISFSFDGEDFTIDLSEENAEKFREAIRPYTEKASR
TMSQRTPVGHDPKDVRQWAKSKKIDIAARGKIPQEVIDAYVQAHKR
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcacgccgagaaatcacccagttttttgatgacatagataatacgcccctcgatgag
tccgaggtccgagttatctcttttagctttgatggagaagacttcaccatcgatctctcg
gaagaaaacgcagaaaagttccgcgaggcaatccgcccgtatacggagaaggcctccaga
actatgagccagcgcacccccgtgggtcacgaccccaaggacgtgcggcagtgggctaag
tctaaaaaaatagatattgcggcacgtggcaagatcccgcaagaggtcattgacgcatac
gtccaagcccacaagcgctag

DBGET integrated database retrieval system