KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2009Help
Entry
Cp1002_2009       CDS       T01876                                 

Gene name
mcbR
Definition
(GenBank) TetR family transcriptional regulator
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: ADL21865
Position
complement(2221265..2221900)
Genome map
AA seq 211 aa AA seqDB search
MALLAEAKSTKTAGRRRNRPSPRQRLLESATRLFTTEGIRVIGIDRILREADVAKASLYS
LFGSKDALVIAYIENLDEQWRASYYERTKNMVQPEDKILAFFDQCIEEEPQKQYRGSHFQ
NAANEYPRPETDMEKGIVLAVKEHRDWCLKTLTDLLTEKNGYPGTTQAHQLMIFLDGGLA
GGRLTHSLESLKTARDLAVQLLSAPPADYSI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtggctcttttggccgaggcgaagagtacgaaaactgcggggcggcgtcgtaaccgcccg
agtccgagacaacgcctcctagaaagcgctacacgtctttttactaccgagggaatccgg
gtcatcggtattgaccggatactccgggaagcggatgtggccaaagccagcctgtactca
ctttttgggtctaaagacgcacttgttattgcctatatagagaacctggatgagcaatgg
cgtgcgtcctactatgaacgcacaaaaaatatggtccagcctgaagataaaatcctggct
ttttttgatcagtgcatcgaagaagaaccacagaaacagtaccgaggatctcattttcaa
aacgctgccaatgagtacccgcgtccggaaacagatatggaaaagggaattgtgctggca
gtaaaagagcatcgcgactggtgtttgaaaacactcaccgatctgctgacagagaagaat
ggttatcccggaaccacgcaggcgcatcaacttatgatttttcttgatggcggcctggcc
ggagggcgccttactcattcattggaatcgctcaagactgcccgcgacctggccgtacag
cttttgtccgcgcctcccgccgattattcaatttag

DBGET integrated database retrieval system