KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2011Help
Entry
Cp1002_2011       CDS       T01876                                 

Definition
(GenBank) Transglycosylase associated protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly_assoc BaxI_1
Motif
Other DBs
NCBI-ProteinID: ADL21867
Position
complement(2222854..2223111)
Genome map
AA seq 85 aa AA seqDB search
MLGLGIIGWIIIGGLAGWIASKIKGTDAQQGIGLNILVGVVGGLLGGWLLKLFGVDVAGG
GIIFSFLTCLLGAVILLSIVQLVRK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtctaggaattatcggttggatcattattggtggtcttgctggctggattgcc
tccaagatcaagggcactgatgctcagcaaggtattggccttaatatcctcgtgggtgtt
gtcggcggccttcttggaggttggctcctgaaactatttggtgtagatgttgccggcggc
ggcattatctttagcttccttacctgcttgcttggtgcggtgattctgctcagcattgtt
caattggttcgtaagtag

DBGET integrated database retrieval system