KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2012Help
Entry
Cp1002_2012       CDS       T01876                                 

Gene name
uspA
Definition
(GenBank) Universal stress protein A
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-ProteinID: ADL21868
Position
complement(2223461..2224390)
Genome map
AA seq 309 aa AA seqDB search
MSPREERLRKMTAENIVVVAVDGSEASNNAVRWAANTANKRGVPLRLAASYTMPQFLYAE
GMVPPQELFDELQTETMATVEAARTLAHEVAPDIKIGYTIAEGSPIDMLLEMSSEVTMIV
MGSRGLGGLSGMVMGSVSAAVVSHAKCPVVVVREDNQVTDANKYGPVVVGVDGSEVSQRA
TEFAFEEAQARGAKLVAIHTWMDMQVQASLAGLAAAQQEWNVIEEEQTQLLHDRIQPLLE
RFPDVNVDMVITRDRPIRALEDSAKDAQLLVVGSHGRGGFRGMLLGSTSRALLQSAPCPM
VVVRPPDKD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccccgtgaagaaaggctcaggaaaatgactgccgagaacatcgtcgtcgtcgca
gttgacggctctgaagcatcaaataatgcggttcgctgggcggcaaacaccgcaaacaag
cgtggtgttccgctgcgcttggccgccagctacaccatgccacaatttctctacgctgag
ggaatggttccgcctcaggagcttttcgacgagctccagacggagaccatggcaacagtc
gaagctgctcgaaccctcgcgcatgaggtagcgccagacatcaagatcggctacaccatc
gcggaggggagccccatagacatgctcctggaaatgtctagtgaggtcacaatgattgtg
atgggctctcgtggcttgggcggcctgtccggcatggtcatgggctccgtttctgctgct
gtagtaagccacgctaagtgcccggtggtcgtggttcgtgaggataaccaggtaactgac
gccaacaagtatggtccggttgtcgtcggcgtggatggctctgaggtctcccaacgggca
actgagtttgcttttgaagaggctcaggctcgaggtgccaaacttgttgctatccatacg
tggatggacatgcaagtacaggcctctcttgcgggcctggcagcggcgcagcaggaatgg
aatgttattgaggaagagcagacgcagcttctccatgatcgcattcaacccctgctggag
cgtttccccgacgtgaatgtagatatggtgattaccagggatcggccgattcgtgctctg
gaagattctgccaaggatgcacagttgctggtcgttggttctcatggacgcggtgggttc
cgcggtatgttgctgggatccacatcccgtgcgttgctccaatcggcgccgtgtccgatg
gtggtagtacgcccgcctgataaggattaa

DBGET integrated database retrieval system