KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2014aHelp
Entry
Cp1002_2014a      CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEK49219
Position
2230986..2231297
Genome map
AA seq 103 aa AA seqDB search
MIIQQKTMKKVQQNSDHRCLDETTQQSPNTHTTTPQAQHPEHHSTSITRFHSHQHPHNTT
SCTHQHHNNASCQQHFFHKQHNLLQASHTCRSILHHRDHHTTM
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
ttgatcattcaacaaaaaacaatgaaaaaagtacaacaaaacagtgaccatcgatgcctt
gacgagacaacacaacaatcacccaacacccacaccacaacaccccaagcacaacaccca
gagcatcacagcacaagcatcacacgtttccacagccaccaacacccacacaacacaaca
tcatgcacgcatcagcaccataacaacgcctcatgtcaacaacattttttccacaaacag
cacaatcttttacaagcaagccacacttgccggtcgatactgcaccatcgtgatcatcac
acaaccatgtaa

DBGET integrated database retrieval system