KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2023Help
Entry
Cp1002_2023       CDS       T01876                                 

Definition
(GenBank) MFS family major facilitator transporter
  KO
K08369  MFS transporter, putative metabolite:H+ symporter
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Transporters [BR:cpk02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    Cp1002_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_4
Motif
Other DBs
NCBI-ProteinID: ADL21879
Position
2240565..2241917
Genome map
AA seq 450 aa AA seqDB search
MPSSASVSADSLTRNDRLDRLPFTPQHRRLLWGSGVGWALDAMDVGLISFIMAALVAHWG
LNHTQTSWLASAGFIGMAIGATFGGLLADRFGRRHIFAITLLVYGLATGASALSMSLGVL
IAFRFIVGLGLGAELPVASTLVSEFSPRVIRGRLVVALEAFWALGWIAAACIGAFVISGS
ANGWRWALALGCVPALYAIYVRLGLPESVRFLEAKGRHAEAEQVVRSFEQSAEEDGCEIA
KLKALPHPDREDDAGEKQGIFSGRYRKRTAALWIIWFCINLSYYGAFIWIPSLLVSSGFP
LVKSFEFTLIITLAQLPGYAVSAWLIEKWGRRSTLVLFLIGSACAAGFYSVSSTETMIIM
AGCCLSFFNLGAWGALYAIGPELYPSRMRGAGTGAAAGFGRIASIIAPLIVPPVVAVGGT
MALFVLFGAAFVIAAAATLVLPEQKGKALA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccaagctcagcttccgtctctgcagatagtctgactagaaacgacagactcgatcgg
cttcctttcacccctcagcaccgccggctgctctggggatccggcgttggttgggcgctt
gatgcgatggacgtcggtctcatctcgtttatcatggcagctctcgtcgcccactggggt
ttgaatcatacgcaaacatcatggttggcatctgcaggattcatcgggatggcaatcggc
gctacttttggtggtttgctagcagaccgctttggtcgccgacatatttttgctatcact
ttgttggtttatggtcttgctaccggtgcttcggcattatccatgagcctgggtgtgctc
atcgccttccgttttatcgtgggattaggtctcggcgcagagttgcctgtggcatccacg
ctggtttccgagttctccccacgggttatccggggacggctcgtcgtggctctcgaggct
ttttgggcactcggctggattgccgcggcttgcatcggcgcctttgtaattagtggttcc
gccaatggctggcgctgggccttagccctagggtgcgtccccgctctctacgctatctat
gtccgcttgggactacctgaatcagtccgcttcctagaagctaaggggcgccacgctgaa
gccgagcaggttgtacgttcctttgagcaaagcgccgaagaagacggctgcgagatagca
aagctcaaggctcttcctcaccccgatagagaagacgacgcgggagaaaagcagggaatt
ttttccggcagatatcggaaacgcaccgctgcattgtggattatttggttctgcatcaac
ctctcctactacggtgcctttatttggatcccatcgcttctggtttctagtggcttcccc
ctggtcaaatcctttgagttcacactgatcattaccttggctcagctaccgggttatgcc
gtctccgcatggttgatcgaaaaatggggtcgccgttccacccttgtgctctttctcatt
ggttccgcctgcgccgcagggttctacagcgtatccagcacagagaccatgatcatcatg
gcggggtgctgcttgtccttcttcaaccttggggcttggggcgctctctacgccatcggc
cccgagttgtatccgtctcgtatgagaggcgcaggcactggcgctgctgccggcttcggc
cgcatcgcttctatcatcgcgcctcttatagtgccgcctgttgtagctgtcggtggcacg
atggcgctctttgtccttttcggagctgcttttgttatcgcagctgccgccacccttgtg
ctaccagagcaaaagggtaaggcgctcgcttag

DBGET integrated database retrieval system