KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2029Help
Entry
Cp1002_2029       CDS       T01876                                 

Gene name
ssb1
Definition
(GenBank) Single-strand DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk03030  DNA replication
cpk03430  Mismatch repair
cpk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Cp1002_2029 (ssb1)
   03430 Mismatch repair
    Cp1002_2029 (ssb1)
   03440 Homologous recombination
    Cp1002_2029 (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cpk03032]
    Cp1002_2029 (ssb1)
   03400 DNA repair and recombination proteins [BR:cpk03400]
    Cp1002_2029 (ssb1)
   03029 Mitochondrial biogenesis [BR:cpk03029]
    Cp1002_2029 (ssb1)
DNA replication proteins [BR:cpk03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Cp1002_2029 (ssb1)
DNA repair and recombination proteins [BR:cpk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     Cp1002_2029 (ssb1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Cp1002_2029 (ssb1)
Mitochondrial biogenesis [BR:cpk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    Cp1002_2029 (ssb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2 Ribosomal_S3_C GRP
Motif
Other DBs
NCBI-ProteinID: ADL21885
Position
complement(2246653..2247222)
Genome map
AA seq 189 aa AA seqDB search
MAQGDVNITVVGNLVADPELRFTPAGAAVANFRIASTPRRYDSRSNQWVDGEALFLQCNV
WRQAAENVAESLTKGMRVIVTGRLRQRSYETREGEKRTVMELEVDEVGPSLRYASASINR
NPREGGNGGNYGGGNFGGNSGGGFGGNGGSQGGFGGGQQGNQNSAPANDPWSSAPPAGGF
GGADAEPPF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggagacgtcaacattacggtcgttggcaacttggttgctgacccggaactt
cgcttcaccccagcgggtgcggcggttgctaatttccgtatcgcctcgactccacgccgg
tatgactctcggtcaaaccagtgggtagatggtgaggccttgttcctacaatgcaacgtg
tggcgccaggcagcagagaacgtcgcagagtccttgactaagggcatgcgcgtgattgtt
accgggcgtttgcgccagcgctcttatgagactcgtgagggcgaaaagcgtactgttatg
gagcttgaggtcgatgaggtcggcccatccttgcggtatgcgtcggcaagcattaaccgc
aaccctcgtgagggcggtaacggcggaaattatggtggcggaaacttcggtgggaattca
ggcggtggctttggtggcaacggcggatcccaaggtgggttcggcgggggccagcagggc
aaccaaaactccgcaccggctaatgacccgtggagcagcgctccgccagcaggtggattc
ggcggtgctgacgctgagccgccattctaa

DBGET integrated database retrieval system