KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2043Help
Entry
Cp1002_2043       CDS       T01876                                 

Gene name
dps
Definition
(GenBank) DNA protection during starvation protein
  KO
K04047  starvation-inducible DNA-binding protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Chromosome and associated proteins [BR:cpk03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Cp1002_2043 (dps)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin
Motif
Other DBs
NCBI-ProteinID: ADL21899
Position
complement(2257698..2258189)
Genome map
AA seq 163 aa AA seqDB search
MKNFTVPGINEADAKQLIDHLQERLTDYNDLHLILKHAHWNVHGQNFIAVHEMIDPQVDI
VRGYADEVAERIATLGGSPIGTPAGHVENRKPLEYTVNSASTHDHLTELNKVYTKVLEGV
RESMASAGDLDSVTEDMYIGQAAELEKFQWFVREHIVDDNGNL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatttcactgttccaggaatcaatgaagcagacgccaagcagcttatcgatcac
ctgcaggagcggctcaccgactataacgatcttcatctcattctcaagcacgcccattgg
aatgtccatggtcaaaatttcatcgcagttcatgagatgatcgacccccaggttgacatc
gtgcgtggctacgcagatgaagtagcagaaagaatcgccacccttggtggctcccccatt
ggcacaccggcaggccacgtggaaaaccgcaagccgctggaatacacggtcaatagtgca
agcacccacgatcacctcactgagctcaacaaggtatataccaaggttctagagggggta
cgcgagtccatggctagtgccggcgacctcgactcggttactgaggacatgtacatcggg
caagccgctgaattggagaagttccagtggttcgtgcgtgagcacatcgtcgacgacaat
gggaacctgtaa

DBGET integrated database retrieval system