KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2059Help
Entry
Cp1002_2059       CDS       T01876                                 

Gene name
nagB
Definition
(GenBank) Glucosamine-6-phosphate isomerase
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00520  Amino sugar and nucleotide sugar metabolism
cpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cp1002_2059 (nagB)
Enzymes [BR:cpk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     Cp1002_2059 (nagB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso Sugar-bind PsaA_PsaB Herpes_UL21 DUF4443
Motif
Other DBs
NCBI-ProteinID: ADL21915
Position
complement(2278960..2279739)
Genome map
AA seq 259 aa AA seqDB search
MEIIITPTHKEAAVIAADIFEGYIRQGKTLGLATGSTPGSTYAELVRRHREEGLSFAQCQ
AFLLDEYVGLPREHEQTYYQTIRREITSHVDIDDSAVHSPDGTAENPSAAAEAYDQSIRD
AGGVDIQVLGIGTDGHIAFNEPTSSLVSRTRIKTLHPDTVRDNSRFFDNDESQVPHHVMT
QGIGTICEAGHLVMLAFGENKADAVKSMVEGPVSAMVPASALQMHKHVTVILDEAAASKL
ENIEYYNYALAHKPEWQKF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcatcattactcccacccacaaagaggcggcggtaatcgctgcggacattttt
gaggggtatatcaggcaggggaagaccttaggtttagccactggctcgacgccgggaagc
acctacgccgagttggtgcgcaggcatcgggaagaaggcctgtcttttgctcaatgtcag
gcattcctcctcgacgagtatgtaggtttgcctcgagagcacgagcagacttattaccag
actattcgccgagagatcacgtctcacgtggatattgatgactccgctgttcacagccct
gatggaacggcggaaaacccaagcgctgctgccgaagcttatgatcaatcaatacgggat
gccggtggcgtggatattcaggttttaggtattggaactgatggccatatcgcgtttaat
gagccgacctcgtcactggtaagtcggactcgtatcaagactttgcatccggataccgta
cgagataactcgcgcttctttgataatgacgagtctcaggtgccgcatcacgtgatgact
caggggattggcacgatctgcgaagccggtcatcttgtgatgctggcctttggggagaac
aaggctgacgcggttaaatccatggtagaagggcctgtcagcgctatggttccagcctcg
gccttgcagatgcacaagcacgtgactgtgatcctggatgaagctgccgctagcaagcta
gagaacatcgagtattacaactatgcattggcgcataaaccagaatggcaaaaattttaa

DBGET integrated database retrieval system