KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2068Help
Entry
Cp1002_2068       CDS       T01876                                 

Gene name
nanL
Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00261  Monobactam biosynthesis
cpk00300  Lysine biosynthesis
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01120  Microbial metabolism in diverse environments
cpk01130  Biosynthesis of antibiotics
cpk01230  Biosynthesis of amino acids
Module
cpk_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Cp1002_2068 (nanL)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Cp1002_2068 (nanL)
Enzymes [BR:cpk01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Cp1002_2068 (nanL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS PucR
Motif
Other DBs
NCBI-ProteinID: ADL21924
Position
2289584..2290507
Genome map
AA seq 307 aa AA seqDB search
MSSIVSGIVPPVLTPLHADRSLDLESLARLVEHLIDAGVDGLFALGSSGEVAFLSDEDRG
IVIREIVKLAKGRVPVYAGVIDTQANRVIEHVRQAEAAGVDAVVVTAPFYAICGPNEIEA
HFRTIAEATDLPIIAYDIPVCVYSKLPSEMLVKLGKDGVLAGVKDSSGDDVSFRRLVMLN
KTAGSPLTLLTGHEAVVDGSFIAGADGCVPGLGNVDPAGYVRMWKAAQSGEWETVRKEQD
RLAALFEIVFQPRGKVGPAAGVGSFKTALELMGVFSSNLMSAPLAPIDDAESREDIAAIL
RTAGLLD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatcgtttccggcatcgtccccccagttcttacgcccctacatgcagaccgc
agccttgatcttgaatcactagctcgcctcgttgaacacctcatcgatgctggtgttgac
ggtttgtttgccctaggttcttccggagaagtcgctttcctcagcgatgaggatcgcggc
attgtgatcagggaaattgtgaagctagccaaaggccgcgttcctgtgtacgccggggta
attgacacccaggctaatcgcgtgatcgaacatgtccgtcaggcagaggcagctggcgta
gacgccgtagtggtcacggcacccttctatgccatctgtggccccaacgagatcgaagca
catttccgcactatcgcagaggccaccgacctccccattattgcttatgacatccccgtg
tgcgtgtactccaagctgccctcagaaatgctggtcaaacttggcaaggacggcgtcttg
gcgggcgtgaaggattcctccggtgatgatgtttccttccgccgcttggtcatgctcaac
aagacggctggctcgccgttgaccctgctgactggccacgaggcagttgtagacgggtcc
ttcatcgcaggtgccgacggctgtgtccccggtctgggcaacgtcgatcctgcgggatat
gttcgcatgtggaaggcagcccagtccggcgagtgggagaccgtgcgcaaagagcaggat
cgtctcgccgcactctttgaaatcgtcttccagccccgtggcaaggtcgggccggctgcc
ggcgttggatcgttcaagactgccctggaactcatgggcgtgttctcttcaaacttgatg
tctgcaccactcgcgcctatcgacgacgccgagtctcgtgaagacatcgcagcaatccta
cgcaccgcaggtttgctggactga

DBGET integrated database retrieval system