KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2075Help
Entry
Cp1002_2075       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
  KO
K09946  uncharacterized protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Cp1002_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1508 CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ADL21931
Position
complement(2295924..2296103)
Genome map
AA seq 59 aa AA seqDB search
MAGTFEVYEDRSGKFRFRLKAGNGEIVASGEAYESKASAIKGTEAVQRAAAGAKLKDLT
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atggctggaacattcgaagtatatgaagataggtccggtaaattccgctttcgactaaag
gccggaaacggtgagatcgttgccagcggagaggcctatgagtctaaagcgagcgctatt
aagggtacggaagcagtacaacgtgccgcagcaggggcaaaactgaaagacttgacctag

DBGET integrated database retrieval system