KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2084Help
Entry
Cp1002_2084       CDS       T01876                                 

Gene name
trpG
Definition
(GenBank) Anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01130  Biosynthesis of antibiotics
cpk01230  Biosynthesis of amino acids
cpk02024  Quorum sensing
Module
cpk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_2084 (trpG)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Cp1002_2084 (trpG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cp1002_2084 (trpG)
Enzymes [BR:cpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Cp1002_2084 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ADL21939
Position
2305653..2306300
Genome map
AA seq 215 aa AA seqDB search
MNSTDTHVVLLDNHDSFVYNLLDAFAVAGYRCTVFRNSVGIKEILAAKPDIICLSPGPGH
PRDAGCMMELIDQTLGHIPVLGICLGFQALLEHFGGDVRACGPVHGITDLMKLNKQGLQS
PIFHGLTVDGFPGSQKGEHVPVARYHSLGCTEAPKELTVLGTCPSLIGPVAMAAEARAHA
AVGLQFHPESILSPSGPIILQRCIAHLSQYVKDHN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgaccgacactcacgtagtacttctagataaccacgactcttttgtttataac
ctgctcgatgcctttgctgtcgcaggctatcgctgcactgtcttccgcaactcagtaggg
ataaaagagattctggcagccaagccagatatcatttgtctttccccaggccctggccat
cctcgagatgcaggttgcatgatggaacttatcgatcaaacgttgggccacatcccagtc
cttggcatttgcctaggattccaggcactcctagagcactttgggggagatgtccgcgca
tgtggccccgttcatggaatcacagatcttatgaagctgaataagcaaggcttgcagagc
cccatatttcacggcctgaccgttgacggctttcccggtagccagaagggtgagcatgtt
cccgtagctcgttatcattccctcggatgcacggaagccccaaaggaattaaccgtgttg
ggcacttgcccttcactcattgggccagtggcaatggcagccgaagcacgggcacatgcc
gctgtgggattgcaatttcatcccgagtcaatattaagcccttccggaccgatcatctta
cagcgctgcatcgcccatctttcccaatacgtcaaggaccataattaa

DBGET integrated database retrieval system