KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2088Help
Entry
Cp1002_2088       CDS       T01876                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00260  Glycine, serine and threonine metabolism
cpk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01130  Biosynthesis of antibiotics
cpk01230  Biosynthesis of amino acids
Module
cpk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp1002_2088 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_2088 (trpA)
Enzymes [BR:cpk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp1002_2088 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NanE Amidohydro_2 IMPDH
Motif
Other DBs
NCBI-ProteinID: ADL21943
Position
2310496..2311335
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPTPEASLSIIRTAVSAGADALELGIPFSDPVAD
GPTIQRSHLRALDNGATVDSSLKLISHIRSEFPELPIGLLIYGNVPFTRGLDSFYQEFAA
AGADSILLPDVPVREGGAFIAAAQRARIAPIFIAPAQASEETLHAVATHSEGYIYAISRD
GVTGTERESSTSGLIDVVNNINKFGGAPVLLGFGISTPQHVREAIDAGARGVITGSAITA
IIERHCIGQHPAPATIDDMSALQSEIFAFISEMKAATRR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaatctttttacccggctagaacaatccaatgagggtgcctttgtt
cccttcatcatgcttggagaccccacccctgaagcatcattatcaatcatccgtaccgcc
gtcagtgccggcgcagacgcccttgagcttgggatcccattctcagacccagtagctgac
gggcctaccattcagcgttctcatctccgcgccctggataatggggcaacggttgattcc
tcattaaagctcatctctcacattcgttcagaattccccgaactacccatcggcctcttg
atttatggcaacgttccatttacccgtggactagatagcttctatcaagaatttgccgca
gccggcgccgattccattttgcttcccgacgttcccgtgagggaggggggagccttcatc
gcagcggcacagagagcgagaatcgcacccattttcatcgccccggcacaggcgtctgaa
gagaccctccatgcagtagcaacacattccgagggatacatctatgcaatttctcgtgat
ggagttaccggaacggaacgagaatcttccaccagtggtctcatcgatgtagtaaacaac
atcaataaattcggcggagcgccggtacttctagggttcggaatttccacgcctcagcat
gtccgtgaagcgatagatgccggcgccaggggagtaatcactggatccgcaatcactgcg
attattgaaagacactgcatcggccaacatcctgcacccgcaacaatcgatgacatgtct
gcactgcaatcggagattttcgctttcatctcagaaatgaaagcggcgactcgcagataa

DBGET integrated database retrieval system