KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2092Help
Entry
Cp1002_2092       CDS       T01876                                 

Gene name
azlD
Definition
(GenBank) Branched-chain amino acid transport protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AzlD DUF1656
Motif
Other DBs
NCBI-ProteinID: ADL21947
Position
complement(2313289..2313642)
Genome map
AA seq 117 aa AA seqDB search
MTLAQLGLPDGVTLSSVLIVLLPAAVITFMLRWLPFSAVKLLKGSALMSMLAITMPVGVM
VVLVMYTLSNARGATGGLLPALIATAVTLLLHWWRKDCGLSIIGGTVFYMFLVNLVW
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgctcagttgggtttgcccgatggggtcacactttcctctgtgcttatcgtg
cttttgccagcggctgttattacttttatgcttcggtggcttcctttttccgcggttaag
ctccttaaaggcagtgcgttgatgtccatgctcgcgataaccatgcctgtgggtgtgatg
gtggtgttagttatgtacacgctttctaatgcgcgaggcgctacgggaggccttcttcct
gcgctcattgccacggctgtgacgttgcttttgcactggtggcggaaggactgtggctta
tccatcatcggtggaacagttttctatatgtttttggtcaacctggtgtggtga

DBGET integrated database retrieval system